DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and COLEC10

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_006429.2 Gene:COLEC10 / 10584 HGNCID:2220 Length:277 Species:Homo sapiens


Alignment Length:79 Identity:20/79 - (25%)
Similarity:32/79 - (40%) Gaps:9/79 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LLTDPLWTSG--------TDLASDNNWVWFSKGRAVNYRNFQNGLPGYSSDNRHCLGINGINGLW 158
            |:.|.:..||        .||..:..:::.......||.|:..|.|.....:..|:.:.. :|.|
Human   194 LIADYVAKSGFFRVFIGVNDLEREGQYMFTDNTPLQNYSNWNEGEPSDPYGHEDCVEMLS-SGRW 257

  Fly   159 VNENCSELRYFVCE 172
            .:..|....|||||
Human   258 NDTECHLTMYFVCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 20/79 (25%)
COLEC10NP_006429.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..107
Collagen 45..111 CDD:189968
CLECT_collectin_like 157..272 CDD:153061 20/79 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.