DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and zmp:0000000937

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_021327947.1 Gene:zmp:0000000937 / 101884588 ZFINID:ZDB-GENE-130530-940 Length:290 Species:Danio rerio


Alignment Length:146 Identity:32/146 - (21%)
Similarity:56/146 - (38%) Gaps:24/146 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 QLPAFSPFSLRDGRFAIGAFAKVNWFQAQATCAAYGYTLVSITSEQDQRSLRNFLFNYARNQQDL 102
            ||..|...:.....|...:..:.:|.:::..|...|..|:.|.::|:|    :|:.....|.:..
Zfish   152 QLQVFGQEAYYQSSFYYLSSERKSWTESRRDCKDRGADLIIINNKQEQ----DFIMKITSNNEFW 212

  Fly   103 --LTDP------LWTSGTDLASDNNWVWFSKGRAV--NYRNFQNGLPGYSSDNRHCLGINGINGL 157
              |||.      .|..|::|.|.   .|.|.|...  |.|..:|....:...:...:|       
Zfish   213 IGLTDSDKEGIWKWVDGSNLTSR---FWASSGSITEPNGRKTENCAVTHLKKHPELIG------- 267

  Fly   158 WVNENCSELRYFVCEK 173
            |::..|.....::|||
Zfish   268 WLDVACDGAYQWICEK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 26/123 (21%)
zmp:0000000937XP_021327947.1 CLECT_DC-SIGN_like 161..283 CDD:153060 27/135 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.