DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and LOC100494969

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_031755235.1 Gene:LOC100494969 / 100494969 -ID:- Length:312 Species:Xenopus tropicalis


Alignment Length:162 Identity:39/162 - (24%)
Similarity:61/162 - (37%) Gaps:28/162 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ESDLLPTSPAPGNDTAEEPQLPAFSPFSLRDGRFAIGAFAKVNWFQAQATCAAYGYTLVSITSEQ 83
            |...||||.:..||            :.|........:....:||:|:|.|......||.|::..
 Frog   172 EQKTLPTSASCDND------------WHLLGESCYYFSVTSSDWFKARAFCKTKESDLVVISTAF 224

  Fly    84 DQRSLRNFLFNYARNQQDLLTDPLWTSGTDLASDNNWVWFSKGRAVNYRN----FQNGLPGYSSD 144
            :|.::.|.:     ..:.|.....|...||:.|:..|.|..   ..||..    ::.|.|..:..
 Frog   225 EQTAINNII-----KAKGLELTRFWIGLTDMNSEGTWEWLD---GTNYNTAFKFWRAGEPNDAGG 281

  Fly   145 NRHCLGINGINGLWVNENCSELRYFVCEKRCQ 176
            |..|..|. .||.|.:.:|:   |..|...|:
 Frog   282 NEDCAHIR-TNGEWNDVHCT---YAECNAICE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 30/117 (26%)
LOC100494969XP_031755235.1 CLECT_DC-SIGN_like 182..310 CDD:153060 34/152 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.