DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and si:ch211-125e6.11

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001124136.1 Gene:si:ch211-125e6.11 / 100170830 ZFINID:ZDB-GENE-070912-35 Length:146 Species:Danio rerio


Alignment Length:116 Identity:29/116 - (25%)
Similarity:53/116 - (45%) Gaps:12/116 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VNWFQAQATCAAYGYTLVSITSEQDQRSLRNFLFNYARNQQDLLTDPLWTSGTDLASDNNWVWFS 124
            |:|..|:..|..:|..|.|:.:..:...|.|.:.:.:|         .|..|.|...:..|:| :
Zfish    41 VSWITAEKNCQGFGGNLASVHNRLENDFLMNMVPSSSR---------CWIGGHDGEQEGQWLW-T 95

  Fly   125 KGRAVNYRNFQNGLPGYSSDNRHCLGINGI-NGLWVNENCSELRYFVCEKR 174
            .|...:|.|:.:..|. :..:.:|:.||.. |..|.::.||....|:||::
Zfish    96 DGSMFDYNNWCSDEPN-NQRSENCMEINWTSNHCWNDQGCSTSMGFMCERK 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 28/113 (25%)
si:ch211-125e6.11NP_001124136.1 CLECT 32..144 CDD:153057 28/113 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11087
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5404
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.