DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8343 and si:ch211-214k5.3

DIOPT Version :9

Sequence 1:NP_610207.1 Gene:CG8343 / 35544 FlyBaseID:FBgn0040502 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_009303575.2 Gene:si:ch211-214k5.3 / 100034611 ZFINID:ZDB-GENE-041210-206 Length:291 Species:Danio rerio


Alignment Length:116 Identity:22/116 - (18%)
Similarity:44/116 - (37%) Gaps:12/116 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KVNWFQAQATCAAYGYTLVSITSEQDQRSLRNFLFNYARNQQDLLTDPLWTSGTDLASDNNWVWF 123
            |.||.::...|...|..|:.|.::::|..::.....          |.:|...:|...:.:|.|.
Zfish   186 KKNWSESTRNCRDRGADLIIINNKEEQDFVKKISGG----------DVVWIGLSDSDEEGSWKWV 240

  Fly   124 SKGRAVNYRNFQNGLPGYSSDNRHCLGINGINGLWVNENCSELRYFVCEKR 174
            ......:...|............:| .::..:| |.:..|:....::||||
Zfish   241 DDPSMTSGFRFWGTFEPNGKRGENC-AVSRSSG-WADYPCNNYFQWICEKR 289

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG8343NP_610207.1 CLECT 59..173 CDD:153057 19/113 (17%)