DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6w1 and CYP97A3

DIOPT Version :9

Sequence 1:NP_001286145.1 Gene:Cyp6w1 / 35543 FlyBaseID:FBgn0033065 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_564384.1 Gene:CYP97A3 / 840067 AraportID:AT1G31800 Length:595 Species:Arabidopsis thaliana


Alignment Length:536 Identity:124/536 - (23%)
Similarity:212/536 - (39%) Gaps:122/536 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FPVVGCTREFLTAKVPFFEQIQKFHEAPG----FENEPFV-----------GVY-MTHRPA--LV 82
            |...|..:::  .|||         ||.|    ..||.|.           |:: :|..|.  |:
plant   101 FDWTGSDQDY--PKVP---------EAKGSIQAVRNEAFFIPLYELFLTYGGIFRLTFGPKSFLI 154

  Fly    83 IRDLELIKTVMIKKFQYFNNRVLQTDPHNDALGY---KNLFFARSPGWRELRTKISPVFTSGKIK 144
            :.|..:.|.::....:.::..:|.     :.|.:   |.|..|....||..|..|.|......:.
plant   155 VSDPSIAKHILKDNAKAYSKGILA-----EILDFVMGKGLIPADGEIWRRRRRAIVPALHQKYVA 214

  Fly   145 QMYPLMVKIGKNLQDSAERLG-SGTEVQVKDLCSRFTTDLIATIAFGVEANALQDAKSEFFYHNR 208
            .|..|..:....|....:... .|.||:::.|.||.|.|:|....|..:.::|.:.....    .
plant   215 AMISLFGEASDRLCQKLDAAALKGEEVEMESLFSRLTLDIIGKAVFNYDFDSLTNDTGVI----E 275

  Fly   209 AIFSL---TLSRGIDFAIIFMIPALASLA--------RVKLFSRETTKFIRSSVNYVLKE----- 257
            |::::   ...|.:....::.||....::        .:||.:......|.:....|.:|     
plant   276 AVYTVLREAEDRSVSPIPVWDIPIWKDISPRQRKVATSLKLINDTLDDLIATCKRMVEEEELQFH 340

  Fly   258 RERTGEKRNDLIDILLALKREAAANPGKMSKEVDLDYLVAQAAVFQTAGFETSASTMTMTLYELA 322
            .|...|:...::..|||...:.:      ||::..|.:     ....||.||||:.:|.|.|.|.
plant   341 EEYMNERDPSILHFLLASGDDVS------SKQLRDDLM-----TMLIAGHETSAAVLTWTFYLLT 394

  Fly   323 KNEALQDRLRQEIVDFFGDEDHISYERIQEM---PYLSQVVNETLRKY---PIVGYIERECSQPA 381
            ...::..:|::|:....||.    :..||:|   .|.::|:||:||.|   |::  |.|......
plant   395 TEPSVVAKLQEEVDSVIGDR----FPTIQDMKKLKYTTRVMNESLRLYPQPPVL--IRRSIDNDI 453

  Fly   382 EGERFTLEPFHNMELPHGMSIYMSTVAVHRDPQYWPDPEKYDPERF----NSSNRDNLNMDAYMP 442
            .||         ..:..|..|::|...:||.|.:|.|.||::|||:    .:.|..|.|. :|:|
plant   454 LGE---------YPIKRGEDIFISVWNLHRSPLHWDDAEKFNPERWPLDGPNPNETNQNF-SYLP 508

  Fly   443 FGVGPRNCIGMRLGLLQSKLGLVHILRNHRF-----------------HTCD-------KTIKKI 483
            ||.|||.|||......::.:.:..::|...|                 ||.:       |..|.:
plant   509 FGGGPRKCIGDMFASFENVVAIAMLIRRFNFQIAPGAPPVKMTTGATIHTTEGLKLTVTKRTKPL 573

  Fly   484 EWAPTSPV--MASKRD 497
            : .|:.|:  |.:.||
plant   574 D-IPSVPILPMDTSRD 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6w1NP_001286145.1 p450 34..501 CDD:278495 124/536 (23%)
CYP97A3NP_564384.1 PLN02738 1..595 CDD:215393 124/536 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.