DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6w1 and CYP72C1

DIOPT Version :9

Sequence 1:NP_001286145.1 Gene:Cyp6w1 / 35543 FlyBaseID:FBgn0033065 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:289 Identity:61/289 - (21%)
Similarity:106/289 - (36%) Gaps:70/289 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLLLLLGSLTIVFYIWQR--RTLSFWERHG---------------------VKYIRPFPVVGCTR 43
            |:|:|......|.::|.|  |...:.::.|                     |.:..|.|:   ..
plant    16 LILILNWVWRAVNWVWLRPKRLEKYLKKQGFSGNSYRILMGDMRESNQMDQVAHSLPLPL---DA 77

  Fly    44 EFLTAKVPFFEQIQKFHEAPGFENEPFVGVYMTHRPALVIRDLELIKTVMIKKFQYFNNRVLQTD 108
            :||...:||.......|....|   .:.|.|    |.:::.|.|.::.:| .|.:.|....:.:.
plant    78 DFLPRMMPFLHHTVLKHGKKCF---TWYGPY----PNVIVMDPETLREIM-SKHELFPKPKIGSH 134

  Fly   109 PHNDALGYKNLFFARSPGWRELRTKISPVFTSGKIKQMYPLMVKIGKNLQDSAERLGS--GT-EV 170
            .|....|..|   ...|.|.:.|:.::|.|....:|.:.|......|.:.:..|||.|  || |:
plant   135 NHVFLSGLLN---HEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEMLEEWERLASAKGTMEL 196

  Fly   171 QVKDLCSRFTTDLIATIAFGVEANALQDAKSEFFYHNRAIFSLTLSRGIDFAIIFM----IPALA 231
            .....|...|.:::|..:||           :.:.....||.:...: ||..::.:    ||.  
plant   197 DSWTHCHDLTRNMLARASFG-----------DSYKDGIKIFEIQQEQ-IDLGLLAIRAVYIPG-- 247

  Fly   232 SLARVKLFSRETTKFIRSSVNYVLKERER 260
                        :||:.:..|..|:|.||
plant   248 ------------SKFLPTKFNRRLRETER 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6w1NP_001286145.1 p450 34..501 CDD:278495 52/234 (22%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.