DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6w1 and cyp3a4.2

DIOPT Version :9

Sequence 1:NP_001286145.1 Gene:Cyp6w1 / 35543 FlyBaseID:FBgn0033065 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_001015786.1 Gene:cyp3a4.2 / 548503 XenbaseID:XB-GENE-971750 Length:504 Species:Xenopus tropicalis


Alignment Length:514 Identity:143/514 - (27%)
Similarity:253/514 - (49%) Gaps:45/514 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLLLLLGSLTIVFYIWQRRTLSFWERHGVKYIRPFPVVGCTREFLTAKVPF-FEQIQKFHEAPGF 65
            :||..|..|.:::.||   ...::::.|:....|.|.:|...||....|.| .|..:|:.:    
 Frog    13 ILLAALLVLILLYGIW---PYGYFKKMGIPGPTPLPFIGTFLEFRKGMVQFDTECFKKYGK---- 70

  Fly    66 ENEPFVGVYMTHRPALVIRDLELIKTVMIKK-FQYFNNRVLQTDPHNDALG---YKNLFFARSPG 126
                ..|.|...:|.|.|.|..:|||:::|: :..|.||      .|..|.   ...:..|....
 Frog    71 ----MWGTYDGRQPVLAIMDPAIIKTILVKECYTNFTNR------RNFGLNGPFESAITIAEDEQ 125

  Fly   127 WRELRTKISPVFTSGKIKQMYPLMVK----IGKNLQDSAERLGSGTEVQVKDLCSRFTTDLIATI 187
            |:.:|..:||.|||||:|:|:.:|..    :.||:|...|:   ......||:...::.|:|.:.
 Frog   126 WKRIRNVLSPTFTSGKLKEMFQIMKDYSDILVKNIQGYVEK---DEPCATKDVIGAYSMDVITST 187

  Fly   188 AFGVEANALQDAKSEFFYHNRAIFSLTLSRGIDFAII---FMIPALASLARVKLFSRETTKFIRS 249
            :|.|..::|......|..|.:.:....|...:...::   |:.|.|..| .:....::.|:|..:
 Frog   188 SFSVNIDSLNKPSDPFVIHMKKLLKTGLLSPLLILVVIFPFLRPILEGL-NLNFVPKDFTEFFMN 251

  Fly   250 SVNYVLKERERTGEK--RNDLIDILLALKREAAANPGKMSKEVDLDYLVAQAAVFQTAGFETSAS 312
            :|. ..:|:.:.|:.  |.||:.:::..:.....:.....|.:....::||:.:|..||:||:::
 Frog   252 AVT-SFREKRKKGDHSGRVDLLQLMMDSRTTGGNDLSNKHKALTDAEIMAQSVIFIVAGYETTST 315

  Fly   313 TMTMTLYELAKNEALQDRLRQEIVDFFGDEDHISYERIQEMPYLSQVVNETLRKYPIVGYIEREC 377
            .::...|.||.:..:|.||.:||..|..|:...:|:.:.:|.||..|:.||||.:|..|.:||..
 Frog   316 ALSYLFYNLATHPDVQQRLHEEIDSFLPDKASPTYDILMQMEYLDMVIQETLRLFPPAGRLERVS 380

  Fly   378 SQPAEGERFTLEPFHNMELPHGMSIYMSTVAVHRDPQYWPDPEKYDPERFNSSNRDNLNMDAYMP 442
            .|..|        .:.:.:|.|:...:....:.|||:|||:||::.||||:..||.......::|
 Frog   381 KQNVE--------INGVSIPKGIVTLIPAYVLQRDPEYWPEPEEFRPERFSKENRATHTPFTFLP 437

  Fly   443 FGVGPRNCIGMRLGLLQSKLGLVHILRNHRFHTCDKTIKKIEWAPTSPVMASKRDIILR 501
            ||.|||||||:|..||..|:.:|.:|:|.....|.:|:..:|:: |...:..|:.|:|:
 Frog   438 FGDGPRNCIGLRFALLSMKVAIVTLLQNFSVRPCAETLIPMEFS-TIGFLQPKKPIVLK 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6w1NP_001286145.1 p450 34..501 CDD:278495 135/480 (28%)
cyp3a4.2NP_001015786.1 p450 39..496 CDD:365848 136/485 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 239 1.000 Domainoid score I2234
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I3174
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - mtm9369
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.