DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6w1 and Cyp3a73

DIOPT Version :9

Sequence 1:NP_001286145.1 Gene:Cyp6w1 / 35543 FlyBaseID:FBgn0033065 Length:514 Species:Drosophila melanogaster
Sequence 2:XP_038945885.1 Gene:Cyp3a73 / 498198 RGDID:1595705 Length:504 Species:Rattus norvegicus


Alignment Length:522 Identity:146/522 - (27%)
Similarity:263/522 - (50%) Gaps:59/522 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLGSLTIVFYIWQRRTLSFWERHGVKYIRPFPVVGCTREFLTAKVPFFEQIQKFHEAPGFENEP 69
            |||..:.::||.:..||...:::.|:...:|.|       ||...:.::..:.||......:...
  Rat    13 LLLAIILVLFYRFGTRTHGIFKKQGIPGPKPLP-------FLGTVLNYYRGLWKFDMECYKKCGK 70

  Fly    70 FVGVYMTHRPALVIRDLELIKTVMIKK-FQYFNNRVLQTDPHNDALGY--KNLFFARSPGWRELR 131
            ..|::....|...|.|.|:||:|::|: |..|.||     .:...:|.  |::..|:...|:..|
  Rat    71 IWGLFDGQTPVFAIMDTEMIKSVLVKECFSVFTNR-----RNIGPVGIMSKSISVAKDEEWKRYR 130

  Fly   132 TKISPVFTSGKIKQMYPLMVKIG----KNLQDSAERLGSGTEVQVKDLCSRFTTDLIATIAFGVE 192
            ..:||.||||::|:|:|::...|    |.|:...|:   |..:.:|::...::.|:|.:.:|.|.
  Rat   131 AFLSPTFTSGRLKEMFPIIEHYGDILVKYLKQKVEK---GKPLAMKEVFGAYSMDVITSTSFEVN 192

  Fly   193 ANALQDAKSEFFYHNRAIFSLTLSRGIDF-------AIIF-MIPALASLARVKLFSRETTKFIRS 249
            .|::.:.|..|      :..:...:..||       .::| .:..:..:..:.||.:::..|.:.
  Rat   193 INSINNPKDPF------VEKVKKFQRFDFFDPLFLSVVLFPFLTPIYEMLNICLFPKDSVAFFQK 251

  Fly   250 SVNYVLKERERTGEKRNDLIDILLALKREAAANPGKMSKEV--DLDYLVAQAAVFQTAGFETSAS 312
            .| |.:|: .|...|....:|.|..:......:..|:|.:.  |:: :||||.:|..|.:||::|
  Rat   252 FV-YRMKQ-TRLDSKHKHRVDFLQLMMNAHNNSKDKVSHKALSDIE-IVAQAIIFIFASYETTSS 313

  Fly   313 TMTMTLYELAKNEALQDRLRQEIVDFFGDEDHISYERIQEMPYLSQVVNETLRKYPIVGY-IERE 376
            |::..||.||.:...|.:|::||.....::...:|:.:.||.||..|:|||.|.||| || :||.
  Rat   314 TLSFVLYSLATHPDSQKKLQEEIDRALPNKAPPTYDTVMEMEYLDMVLNETPRLYPI-GYRLERV 377

  Fly   377 CSQPAEGERFTLEPFHNMELPHGMSIYMSTVAVHRDPQYWPDPEKYDPERFNSSNRDNLNMDAYM 441
            |.:..:        ...:.:|.|..:.:....:..|||:||:||::.||||:..|:.:::...|:
  Rat   378 CKKDIK--------LDGVFIPKGSVVMIPFYTLQHDPQHWPEPEEFLPERFSKENKGSIDPYVYL 434

  Fly   442 PFGVGPRNCIGMRLGLLQSKLGLVHILRNHRFHTCDKTIKKIE------WAPTSPVMAS--KRDI 498
            |||.|||||||||..|:..||.|..:|:|..|..|::|...::      :.|..|::..  .||.
  Rat   435 PFGNGPRNCIGMRFALMNMKLALTKVLQNFSFQLCEETQIPLKLSRQRLFGPEKPIVLKVVPRDA 499

  Fly   499 IL 500
            ::
  Rat   500 VI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6w1NP_001286145.1 p450 34..501 CDD:278495 138/493 (28%)
Cyp3a73XP_038945885.1 CYP3A 67..493 CDD:410743 130/451 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.