DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6w1 and Cyp4d8

DIOPT Version :9

Sequence 1:NP_001286145.1 Gene:Cyp6w1 / 35543 FlyBaseID:FBgn0033065 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster


Alignment Length:508 Identity:116/508 - (22%)
Similarity:208/508 - (40%) Gaps:94/508 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PVVGCTREFLTAKVPFF-----EQIQKFHEAPGFENEPFVGVYMTHRPALVIRDLELIKTVMIKK 96
            |::|..:..|......|     |.:.||..        ...|::.:|..::..|.||        
  Fly    38 PLIGAMQLMLRLNPKTFIKVGREYVLKFGH--------LQRVWIFNRLLIMSGDAEL-------- 86

  Fly    97 FQYFNNRVLQTDPH------NDALGY---KNLFFARSPGWRELRTKISPVFTSGKIKQMYPLMVK 152
                |.::|.:..|      ...||.   ..|..:....|.:.|..|:|.|....::|...:..:
  Fly    87 ----NEQLLSSQEHLVKHPVYKVLGQWLGNGLLLSDGKVWHQRRKIITPTFHFSILEQFVEVFDQ 147

  Fly   153 IGKNL--QDSAERLGSGTEVQVKDLCSRFTTDLIATIAFGVEANALQDAKSEFFYHNRAIFSLTL 215
             ..|:  |..|::....|....:.:|:. ..|:||..|.|.:..|..:..:.:   ..|:...|.
  Fly   148 -QSNICVQRLAQKANGNTFDVYRSICAA-ALDIIAETAMGTKIYAQANESTPY---AEAVNECTA 207

  Fly   216 SRGIDFAIIFM-IPALASLARVKLFSRETTKFIRSSVNYVLK--ERER----------------- 260
            .....|..::: :..|.:|....|..|: |:.||:...:.:|  |:.|                 
  Fly   208 LLSWRFMSVYLQVELLFTLTHPHLKWRQ-TQLIRTMQEFTIKVIEKRRQALEDQQSKLMDTADED 271

  Fly   261 TGEKRN-DLIDILL--ALKREAAANPGKMSKEVDLDYLVAQAAVFQTAGFETSASTMTMTLYELA 322
            .|.||. .|:|:||  .:......| .::.:|||         .|...|.:|:.|.::..|:||:
  Fly   272 VGSKRRMALLDVLLMSTVDGRPLTN-DEIREEVD---------TFMFEGHDTTTSALSFCLHELS 326

  Fly   323 KNEALQDRLRQEIVDFFGDEDH--ISYERIQEMPYLSQVVNETLRKYPIVGYIERECSQPAEGER 385
            ::..:|.::.:|||...|.:..  :|...:.|:.|:..|:.|:||.||.|..:.|:.....   :
  Fly   327 RHPEVQAKMLEEIVQVLGTDRSRPVSIRDLGELKYMECVIKESLRMYPPVPIVGRKLQTDF---K 388

  Fly   386 FTLEPFHNMELPHGMSIYMSTVAVHRDPQYWPDPEKYDPERFNSSNRDNLNMDAYMPFGVGPRNC 450
            :|.....:..:|.|..|.:....|||.|:.:|:|:::.|||..:.:|  :.....:||..|||||
  Fly   389 YTHSVHGDGVIPAGSEIIIGIFGVHRQPETFPNPDEFIPERHENGSR--VAPFKMIPFSAGPRNC 451

  Fly   451 IGMRLGLLQSKLGLVHILRNHRFHTCDKTIKKIEWAPTSPVMASKRDIILRVE 503
            ||.:...|:.|:.|..|:|.:            |..|....:....:|:||.|
  Fly   452 IGQKFAQLEMKMMLAKIVREY------------ELLPMGQRVECIVNIVLRSE 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6w1NP_001286145.1 p450 34..501 CDD:278495 113/504 (22%)
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 109/480 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2429
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.