DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6w1 and erg5

DIOPT Version :9

Sequence 1:NP_001286145.1 Gene:Cyp6w1 / 35543 FlyBaseID:FBgn0033065 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_593788.2 Gene:erg5 / 2542469 PomBaseID:SPAC19A8.04 Length:543 Species:Schizosaccharomyces pombe


Alignment Length:479 Identity:89/479 - (18%)
Similarity:179/479 - (37%) Gaps:86/479 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PVVGCTREFLTAKVPFFEQIQKFHEAPGFENEPFVGVYMTHRPALVIRDLELIKTVMIKKFQYFN 101
            |.:|   .||.:..|.||   |::..  ::..|...|.:.|:..::..:.:|.:.: :....|..
pombe    62 PFMG---SFLDSMKPTFE---KYNAK--WQTGPLSCVSVFHKFVVIASERDLARKI-LNSPSYVQ 117

  Fly   102 NRVLQTDPHNDALGYKNLFFARSPGWRELRTKISPVFTSGKIKQMYPLMVKI---------GKNL 157
            ..|:  |.....|.:.|..|.......|.|..::.:||:..:....|....:         ..:.
pombe   118 PCVV--DAGKKILKHTNWVFLDGRDHIEYRKGLNGLFTTRALASYLPAQEAVYNKYFKEFLAHSK 180

  Fly   158 QDSAERLGSGTEVQVKDLCSRFTTDLIATIAFGVEANALQDAKSEFFYHNRAI----FSLTLS-- 216
            .|.|:.:....::.|...|..|       ..:.:..:|::....|::....|:    |.:.|.  
pombe   181 DDYAQYMIPFRDINVATSCRTF-------CGYYISDDAIKHIADEYWKITAAMELVNFPIVLPFT 238

  Fly   217 ---RGIDFAIIFMIPALASLARVKLFSRETTK-------FIRSSVNYVLKERERTGEKRNDLIDI 271
               .||....:.|...:.:.|.    ||:..:       .:...::.:::.|:...|        
pombe   239 KVWYGIQSRKVVMRYFMKAAAE----SRKNMEAGNAPACMMEEWIHEMIETRKYKSE-------- 291

  Fly   272 LLALKREAAANPGKMSKEVDLDYLVAQAAVFQTAGFETSASTMTMTLYELAKNEALQDRLRQEIV 336
                .:|.|..|..:.:|...:.:......|..|..:.::|.||.....||.:..:..::|:|.:
pombe   292 ----NKEGAEKPSVLIREFSDEEISLTFLSFLFASQDATSSAMTWLFQLLADHPDVLQKVREEQL 352

  Fly   337 DF-FGDED-HISYERIQEMPYLSQVVNETLRKYP---IVGYIERECSQPAEGERFTLEPFHNMEL 396
            .. .||.| .:|.:.:::|.|...||.|.||..|   :|.|..::.        |.:.|  :..:
pombe   353 RIRKGDIDVPLSLDLMEKMTYTRAVVKECLRLRPPVLMVPYRVKKA--------FPITP--DYTV 407

  Fly   397 PHGMSIYMSTVAVHRDPQYWPDPEKYDPERFNSSNRDNLNMDAYMPFGVGPRNCIGMRLGLLQSK 461
            |....:..:......|.:.:|:||.::|:|:..:.....:...:|.||.||..|:|.|..:    
pombe   408 PKDAMVIPTLYGALHDSKVYPEPETFNPDRWAPNGLAEQSPKNWMVFGNGPHVCLGQRYAV---- 468

  Fly   462 LGLVHILRNHRFHTCDKTIKKIEW 485
                    ||......|....::|
pombe   469 --------NHLIACIGKASIMLDW 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6w1NP_001286145.1 p450 34..501 CDD:278495 89/479 (19%)
erg5NP_593788.2 CypX 57..505 CDD:225035 89/479 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 88 1.000 Domainoid score I2119
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I1773
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2429
SonicParanoid 1 1.000 - - X40
TreeFam 00.000 Not matched by this tool.
44.080

Return to query results.
Submit another query.