DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EcR and NR1I3

DIOPT Version :9

Sequence 1:NP_001163061.1 Gene:EcR / 35540 FlyBaseID:FBgn0000546 Length:878 Species:Drosophila melanogaster
Sequence 2:XP_005245750.1 Gene:NR1I3 / 9970 HGNCID:7969 Length:429 Species:Homo sapiens


Alignment Length:361 Identity:95/361 - (26%)
Similarity:150/361 - (41%) Gaps:90/361 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 RRSVTKSAVYCCKFGRACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREKKAQ--- 350
            ||:|:||....|.|..:||:....||.|..|||:|||..|||.:.::.....|: ||.|:||   
Human   108 RRTVSKSIGPTCPFAGSCEVSKTQRRHCPACRLQKCLDAGMRKDMILSAEALAL-RRAKQAQRRA 171

  Fly   351 --------KEKDKMTTSPSSQHGGN-GSLASGGGQDFVKKEILDLMTCEPPQHATIPLLPDEILA 406
                    ||::::..:....|..: |::.    :.||:        ..||.|..|...|     
Human   172 QQTPVQLSKEQEELIRTLLGAHTRHMGTMF----EQFVQ--------FRPPAHLFIHHQP----- 219

  Fly   407 KCQARNIPSLTYNQLAVIYKLIWYQDGYEQPSEEDLRRIMSQPDENESQTDVSFRHITEITILTV 471
                  :|:     ||.:..|:                                .|..:|....|
Human   220 ------LPT-----LAPVLPLV--------------------------------THFADINTFMV 241

  Fly   472 QLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHSSDSIFFANNRSYT-----RDS 531
            ..:::|.|.||.|..:|.||||:|||..:.|:..:.:...:...:.: |......||     |.|
Human   242 LQVIKFTKDLPVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQN-FLCGPLRYTIEDGARVS 305

  Fly   532 YKMAGMADNIEDLLHFCRQMFSMKVDNVEYALLTAIVIFS------DRPGLEKAQLVEAIQSYYI 590
            ..:....:.:|.|.||...:..:::...||.||.|:.:||      ||||:.:...::.:|....
Human   306 PTVGFQVEFLELLFHFHGTLRKLQLQEPEYVLLAAMALFSPAPYLTDRPGVTQRDEIDQLQEEMA 370

  Fly   591 DTLRIYI--LNRHCGDSMSLVFYAKLLSILTELRTL 624
            .||:.||  ..|...|..   .|||||.:|.|||::
Human   371 LTLQSYIKGQQRRPRDRF---LYAKLLGLLAELRSI 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EcRNP_001163061.1 NR_DBD_EcR 261..351 CDD:143535 27/72 (38%)
NR_LBD_EcR 420..652 CDD:132736 56/218 (26%)
NR1I3XP_005245750.1 NR_DBD_like <108..154 CDD:295381 21/45 (47%)
NR_LBD_PXR_like 178..427 CDD:132732 68/290 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24082
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.