DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EcR and nhr-219

DIOPT Version :9

Sequence 1:NP_001163061.1 Gene:EcR / 35540 FlyBaseID:FBgn0000546 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_001309650.1 Gene:nhr-219 / 3565145 WormBaseID:WBGene00020555 Length:408 Species:Caenorhabditis elegans


Alignment Length:103 Identity:35/103 - (33%)
Similarity:49/103 - (47%) Gaps:16/103 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 SPSSSLNGYSANESCDAKKSKKGPAPRVQEELCLVCGDRASGYHYNALTCEGCKGFFRR-SVTKS 295
            |||:|::..|              :|::..|.||||...:.|.|:...:|..|..|||| .||..
 Worm     6 SPSTSISTTS--------------SPKLISEKCLVCDQPSHGNHFGVDSCRACAAFFRRVFVTHK 56

  Fly   296 AVY-CCKFGRACEMDMYMRRKCQECRLKKCLAVGMRPE 332
            ..| |......|..|...|.||::||..:|..:||||:
 Worm    57 QQYKCINELEQCVPDARGRWKCRKCRTDRCFELGMRPD 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EcRNP_001163061.1 NR_DBD_EcR 261..351 CDD:143535 29/74 (39%)
NR_LBD_EcR 420..652 CDD:132736
nhr-219NP_001309650.1 ZnF_C4 23..94 CDD:197701 27/70 (39%)
Hormone_recep 178..381 CDD:278530
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165494
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.