DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EcR and nhr-219

DIOPT Version :10

Sequence 1:NP_724460.1 Gene:EcR / 35540 FlyBaseID:FBgn0000546 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_001309650.1 Gene:nhr-219 / 3565145 WormBaseID:WBGene00020555 Length:408 Species:Caenorhabditis elegans


Alignment Length:103 Identity:35/103 - (33%)
Similarity:49/103 - (47%) Gaps:16/103 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 SPSSSLNGYSANESCDAKKSKKGPAPRVQEELCLVCGDRASGYHYNALTCEGCKGFFRR-SVTKS 295
            |||:|::..|              :|::..|.||||...:.|.|:...:|..|..|||| .||..
 Worm     6 SPSTSISTTS--------------SPKLISEKCLVCDQPSHGNHFGVDSCRACAAFFRRVFVTHK 56

  Fly   296 AVY-CCKFGRACEMDMYMRRKCQECRLKKCLAVGMRPE 332
            ..| |......|..|...|.||::||..:|..:||||:
 Worm    57 QQYKCINELEQCVPDARGRWKCRKCRTDRCFELGMRPD 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EcRNP_724460.1 NR_DBD_EcR 261..351 CDD:143535 29/74 (39%)
NR_LBD_EcR 420..652 CDD:132736
nhr-219NP_001309650.1 ZnF_C4 23..94 CDD:197701 27/70 (39%)
Hormone_recep 178..376 CDD:459675
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.