DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EcR and Pparg

DIOPT Version :9

Sequence 1:NP_001163061.1 Gene:EcR / 35540 FlyBaseID:FBgn0000546 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_037256.1 Gene:Pparg / 25664 RGDID:3371 Length:505 Species:Rattus norvegicus


Alignment Length:414 Identity:114/414 - (27%)
Similarity:179/414 - (43%) Gaps:78/414 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 CLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVY-CCKFGRACEMDMYMRRKCQECRLKKCLAV 327
            |.||||:|||:||....||||||||||::....:| .|...  |.:....|.|||.||.:|||||
  Rat   139 CRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLN--CRIHKKSRNKCQYCRFQKCLAV 201

  Fly   328 GMRPECVVPENQCAMKRREKKAQKEKDKMTTSPSSQHGGNGSLASGGGQDFVKKEILDLMTCEPP 392
            ||....:         |..:..|.||:|:....||.            .|.:..|..||...  .
  Rat   202 GMSHNAI---------RFGRMPQAEKEKLLAEISSD------------IDQLNPESADLRAL--A 243

  Fly   393 QHATIPLLPDEILAKCQARNI--PSLTYNQLAVIYKLIWYQDGYEQPSEEDLRRIMSQPDENESQ 455
            :|.....:....|.|.:||.|  ...|.....|||               |:..:|...|:    
  Rat   244 KHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIY---------------DMNSLMMGEDK---- 289

  Fly   456 TDVSFRHITEI------------------TILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSE 502
              :.|:|||.:                  ::..||.|.|:||.:|.|..:...||:||||....|
  Rat   290 --IKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHE 352

  Fly   503 VMMLRMARRYDHSSDSIFFANNRSY-TRDSYK--MAGMADNIEDLLHFCRQMFSMKVDNVEYALL 564
            ::...:|...  :.|.:..:..:.: ||:..|  .....|.:|....|..:..::::|:.:.|:.
  Rat   353 IIYTMLASLM--NKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIF 415

  Fly   565 TAIVIFS-DRPGLEKAQLVEAIQSYYIDTLRIYILNRHCGDSMSLVFYAKLLSILTELRTLGNQN 628
            .|::|.| |||||...:.:|.||...:..|.:.:...|...|.   .:||:|..:|:||.:..::
  Rat   416 IAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQ---LFAKVLQKMTDLRQIVTEH 477

  Fly   629 AEMCFSLKL--KNRKLPKFLEEIW 650
            .::...:|.  .:..|...|:||:
  Rat   478 VQLLHVIKKTETDMSLHPLLQEIY 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EcRNP_001163061.1 NR_DBD_EcR 261..351 CDD:143535 37/87 (43%)
NR_LBD_EcR 420..652 CDD:132736 60/255 (24%)
PpargNP_037256.1 PPARgamma_N 31..108 CDD:403692
NR_DBD_Ppar 138..221 CDD:143523 40/92 (43%)
Interaction with FAM120B. /evidence=ECO:0000250 205..280 21/112 (19%)
NR_LBD_PPAR 237..504 CDD:132730 69/293 (24%)
9aaTAD. /evidence=ECO:0000250|UniProtKB:P37231 495..503 3/7 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351546
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.