DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EcR and nhr-228

DIOPT Version :9

Sequence 1:NP_001163061.1 Gene:EcR / 35540 FlyBaseID:FBgn0000546 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_001041172.1 Gene:nhr-228 / 188977 WormBaseID:WBGene00020852 Length:396 Species:Caenorhabditis elegans


Alignment Length:244 Identity:54/244 - (22%)
Similarity:97/244 - (39%) Gaps:51/244 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 CLVCGDRASGYHYNALTCEGCKGFFRRSVT-KSAVYCCKFGRACEMDMYMRRKCQECRLKKCLAV 327
            |.:|..||.|.|:..::|..|..||||:.: |.....|: |.:|:...|.   |:.|||:||..:
 Worm    13 CRICDQRAHGNHFGVISCRACAAFFRRTASGKWDNQKCR-GGSCDKKTYY---CKPCRLQKCRDM 73

  Fly   328 GMRPECVVPENQCAMKRREKKAQKEKDKMTTSPSSQHGGNGSLASGGGQDFVKKEILDLMTCEPP 392
            ||               ...|.|..:|.:.|:...|.......|..|..:|       |:.|:..
 Worm    74 GM---------------DTTKFQFNRDNIPTAGQFQLPPQTFEAYVGRPEF-------LLFCDTD 116

  Fly   393 QHATIPLLPDEILAKCQARNI------PSLTYNQLAVIYKLIWYQDGYE--QPSEEDLRRIMSQP 449
            ...:..|:....|.:...|.:      |....|||..:      ..|::  :...::::::    
 Worm   117 APNSKVLIDVRYLLEEAGRLLNNGIITPIWAENQLKKL------TQGFKHIKLDTDNIKKV---- 171

  Fly   450 DENESQTDVSFRHITEITILTVQLIVEFAKGLPAFTKIPQEDQITLLKA 498
               |:.....|..:.|...:||   .::......|.|:.::.|:|:|:|
 Worm   172 ---ETADQKEFMEMWEYYFITV---TKWLMYFDEFQKLNRQIQMTMLQA 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EcRNP_001163061.1 NR_DBD_EcR 261..351 CDD:143535 26/87 (30%)
NR_LBD_EcR 420..652 CDD:132736 14/81 (17%)
nhr-228NP_001041172.1 ZnF_C4 13..76 CDD:197701 25/81 (31%)
Hormone_recep 167..377 CDD:365875 11/58 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165638
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.