DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EcR and nhr-192

DIOPT Version :9

Sequence 1:NP_001163061.1 Gene:EcR / 35540 FlyBaseID:FBgn0000546 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_505584.2 Gene:nhr-192 / 186431 WormBaseID:WBGene00010180 Length:352 Species:Caenorhabditis elegans


Alignment Length:315 Identity:82/315 - (26%)
Similarity:124/315 - (39%) Gaps:92/315 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 ELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECRLKKCLA 326
            :||.:|..:|.|.||..|:|..||.||||...:..||.||:...|........|||.||.::||.
 Worm    16 KLCEICNRQAFGKHYGVLSCYACKMFFRRMSVQKLVYNCKWSNNCFETSPYPLKCQSCRFQRCLD 80

  Fly   327 VGMRPECVVPENQCAMKRREKKAQKEKDKMTT--------SPSSQHG-------GNGSLASGGGQ 376
            .||..|  |.||....:...:|.    |::||        ..|.||.       .|.|||     
 Worm    81 AGMYLE--VHENIVEFENGNQKV----DELTTLLQNLLIMDSSRQHKLKTFYSFDNPSLA----- 134

  Fly   377 DFVKKEILDLMTCEPP-------QHATIPLLPDE--ILAKCQARNIPS-LTY-------NQLAVI 424
                 |||     |.|       |.....:.|:|  .||      |.| ::|       |:|..|
 Worm   135 -----EIL-----ENPGVVTSINQGPNYEVTPEEWAFLA------IYSHISYFLNFDFVNELHDI 183

  Fly   425 YKLIWYQD---------GYEQPSEEDLRRIMSQPDENESQTDV-------SFRHITEITILTVQL 473
            .|.|.:|.         |..:...|...::|: |...|...||       |...:..|....:..
 Worm   184 DKKIIFQHTILKLTYFCGVMRTVNEKRSKMMN-PGGQEIYPDVILQLYEKSKSTLHRICCQPLDK 247

  Fly   474 IVEFAKGLPAFTKIPQEDQ--ITLLKACS------SEVMMLRMARRYDHSSDSIF 520
            ::|:        ::..|:.  :.||..|:      ||..:::::|:.:..|:::|
 Worm   248 LLEW--------EVTDEEYCLMNLLFFCNPAIPEISEDAVVKLSRQQNIYSNALF 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EcRNP_001163061.1 NR_DBD_EcR 261..351 CDD:143535 34/88 (39%)
NR_LBD_EcR 420..652 CDD:132736 24/125 (19%)
nhr-192NP_505584.2 ZnF_C4 17..83 CDD:197701 27/65 (42%)
HOLI 160..321 CDD:214658 30/150 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165615
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.