DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EcR and nhr-181

DIOPT Version :9

Sequence 1:NP_001163061.1 Gene:EcR / 35540 FlyBaseID:FBgn0000546 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_504139.1 Gene:nhr-181 / 185483 WormBaseID:WBGene00018189 Length:406 Species:Caenorhabditis elegans


Alignment Length:389 Identity:97/389 - (24%)
Similarity:146/389 - (37%) Gaps:108/389 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 DLSPSSSLNGYSANESCDAKKSKKGPAPRVQEELCLVCGDRASGYHYNALTCEGCKGFFRRSV-T 293
            |..||||        |.....|....:|....|.|.||||..:|..|.|..|.||..||||:| .
 Worm     7 DPRPSSS--------SSSVSTSSMSSSPSTSSESCAVCGDSVNGKRYGAPACLGCIVFFRRAVIN 63

  Fly   294 KSAVYCCKFGRACEMDMYMRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREKKAQKEKDKMTT 358
            ||...|.|.|. |.:....|..|:.|||:||..|||:||        |::||:....::...:.|
 Worm    64 KSQYKCWKKGN-CVITFASRCVCRCCRLRKCSHVGMKPE--------AIQRRDLLGPRKPKTILT 119

  Fly   359 SPSSQ---------HGGNGSLASGGGQ----DFVKKEILDLMTCEPPQHATIPLLPDEILAKCQA 410
            :..||         ...:.|..|..|:    .|....::.|...:..||....:...:.:...|.
 Worm   120 NDISQSIDVALNFLSSPHSSCESDTGEYSNTTFDIDSLVRLQHDQRSQHEAYGIHHIDTIGCFQM 184

  Fly   411 RNIPSLTYNQLA------VIYKLIWYQDGYEQPSE-----EDLRRIMSQPDENESQTDVSFRHIT 464
            :|  |..|::.|      .:.||     |.|..:|     |..|| :||.|:|...::..|    
 Worm   185 KN--SGKYHKRARASDINFVLKL-----GLENANEWGNQFEPYRR-LSQTDKNSVLSEFGF---- 237

  Fly   465 EITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHSSDSIFFANNRSYTR 529
                              ||..|.|.               .:.|:|.|   :..:...|.::..
 Worm   238 ------------------AFLLIDQG---------------YKTAQRAD---EGFWLLQNETFMH 266

  Fly   530 DSYKMA-----GMADNIE---DLLH-FCRQMF--------SMKVDNVEYALL-TAIVIFSDRPG 575
            .:|..|     .|.:|.|   :|.| |..::.        ::.:|..|.|:| |.:::....||
 Worm   267 PNYFFALSVEDAMKENAEQKAELHHSFVNELVKCVSDPFKNLHIDEFECAILKTVLLLTPSFPG 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EcRNP_001163061.1 NR_DBD_EcR 261..351 CDD:143535 38/90 (42%)
NR_LBD_EcR 420..652 CDD:132736 37/185 (20%)
nhr-181NP_504139.1 NR_DBD_HNF4A 33..107 CDD:143518 36/82 (44%)
HOLI 203..376 CDD:214658 36/174 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165528
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.