DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EcR and nhr-150

DIOPT Version :10

Sequence 1:NP_724460.1 Gene:EcR / 35540 FlyBaseID:FBgn0000546 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_506854.1 Gene:nhr-150 / 182297 WormBaseID:WBGene00007367 Length:342 Species:Caenorhabditis elegans


Alignment Length:37 Identity:9/37 - (24%)
Similarity:15/37 - (40%) Gaps:10/37 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVNYVAPVCNTCEEKRCPMGYKWDGCKCVPDCACLRQ 77
            |:.|...:.|      |.:|   |.| .:.:..|:.|
 Worm   130 RIGYNVSISN------CSIG---DSC-VIHNGVCIGQ 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EcRNP_724460.1 NR_DBD_EcR 261..351 CDD:143535
NR_LBD_EcR 420..652 CDD:132736
nhr-150NP_506854.1 ZnF_C4 2..65 CDD:197701
HOLI 139..310 CDD:214658 7/28 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.