DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EcR and Nr1i3

DIOPT Version :9

Sequence 1:NP_001163061.1 Gene:EcR / 35540 FlyBaseID:FBgn0000546 Length:878 Species:Drosophila melanogaster
Sequence 2:NP_033933.2 Gene:Nr1i3 / 12355 MGIID:1346307 Length:358 Species:Mus musculus


Alignment Length:408 Identity:120/408 - (29%)
Similarity:194/408 - (47%) Gaps:78/408 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 AKKSKKGPAPRVQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMYM 312
            |.:.:.||      ..|:||||||:|||::|||||||||||||:|:|:....|.|...||:....
Mouse    11 ASEEEYGP------RNCVVCGDRATGYHFHALTCEGCKGFFRRTVSKTIGPICPFAGRCEVSKAQ 69

  Fly   313 RRKCQECRLKKCLAVGMRPECVVPENQCAMKRREKKAQKEKDKMTTSPSSQHGGNGSLASGGGQD 377
            ||.|..|||:|||.||||.:.::.....|: ||.::||:..:|.:...:.|              
Mouse    70 RRHCPACRLQKCLNVGMRKDMILSAEALAL-RRARQAQRRAEKASLQLNQQ-------------- 119

  Fly   378 FVKKEILDLMTCEPPQHATIPLLPDEILAKCQARNIPSLTYNQLAVIYKLIWYQDGYEQPSEEDL 442
              :||::                  :||.....|::..: ::|. |.:|...|...:.:|     
Mouse   120 --QKELV------------------QILLGAHTRHVGPM-FDQF-VQFKPPAYLFMHHRP----- 157

  Fly   443 RRIMSQPDENESQTDVSFRHITEITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLR 507
                .||   .........|..:|....||.|::|.|.||.|..:..||||:|||..:.|::.:.
Mouse   158 ----FQP---RGPVLPLLTHFADINTFMVQQIIKFTKDLPLFRSLTMEDQISLLKGAAVEILHIS 215

  Fly   508 MARRYDHSSDSIFFANNRSYTRDSYKMAGMA-DNIEDLLHFCRQMFSMKVDNVEYALLTAIVIFS 571
            :...:...::: ||.....|..:....||.. :.:|.:|||.:.:..:.:...||.|:.|..:||
Mouse   216 LNTTFCLQTEN-FFCGPLCYKMEDAVHAGFQYEFLESILHFHKNLKGLHLQEPEYVLMAATALFS 279

  Fly   572 -DRPGLEKAQLVEAIQSYYIDTLRIYILNRHCGDSMSLV----FYAKLLSILTELRTLGNQNAEM 631
             ||||:.:.:.::.:|..     ...|||.|..:..|.:    .||||:.:|.:||::.|     
Mouse   280 PDRPGVTQREEIDQLQEE-----MALILNNHIMEQQSRLQSRFLYAKLMGLLADLRSINN----- 334

  Fly   632 CFSLKLKNRKLPKFLEEI 649
            .:|.:|:.      |||:
Mouse   335 AYSYELQR------LEEL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EcRNP_001163061.1 NR_DBD_EcR 261..351 CDD:143535 46/89 (52%)
NR_LBD_EcR 420..652 CDD:132736 63/236 (27%)
Nr1i3NP_033933.2 NR_DBD_VDR_like 21..92 CDD:143531 42/70 (60%)
NR_LBD 116..356 CDD:299703 69/296 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24082
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.