DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EcR and rorc

DIOPT Version :9

Sequence 1:NP_001163061.1 Gene:EcR / 35540 FlyBaseID:FBgn0000546 Length:878 Species:Drosophila melanogaster
Sequence 2:XP_031747715.1 Gene:rorc / 100489391 XenbaseID:XB-GENE-481075 Length:422 Species:Xenopus tropicalis


Alignment Length:125 Identity:37/125 - (29%)
Similarity:70/125 - (56%) Gaps:6/125 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 HITEITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHSSDSIFFANNRS 526
            |||:    .:|.||||||.|..|.::...|||.||||.:.|::::||:|.::..:.:|:| ..:.
 Frog   232 HITD----AIQYIVEFAKRLSGFMELNPNDQIVLLKAGAMELLLIRMSRAFNCYNSTIYF-EGKY 291

  Fly   527 YTRDSYKMAGMADNIEDLLHFCRQMFSMKVDNVEYALLTAIVIFS-DRPGLEKAQLVEAI 585
            ...|.::..|..|.|..:...|..:.::.:...|.|..:::|:.. .:|.|::.:.||::
 Frog   292 APLDLFQSLGCNDLISAMFDLCHSLCALNLSEHEMAFFSSMVLLDPSQPWLQEKEKVESL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EcRNP_001163061.1 NR_DBD_EcR 261..351 CDD:143535
NR_LBD_EcR 420..652 CDD:132736 37/125 (30%)
rorcXP_031747715.1 NR_LBD_ROR_like 177..415 CDD:132737 37/125 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.