DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IL1R1 and bdl

DIOPT Version :9

Sequence 1:NP_000868.1 Gene:IL1R1 / 3554 HGNCID:5993 Length:569 Species:Homo sapiens
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:401 Identity:97/401 - (24%)
Similarity:141/401 - (35%) Gaps:101/401 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    56 TWYKDDSKTPVSTEQASRIHQHKE-KLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPN 119
            :||||........:...|.:...: .|...|..:.|.|.|.|.||||..  .::.:..|:    |
  Fly   183 SWYKDGVLLQEVQDLVRRFYMGPDGSLSIDPTMMSDLGEYECKVRNSDG--ELQTAKAFL----N 241

Human   120 LCYNAQAIFKQK---LPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGV---- 177
            :.|.|:.|:...   ||......|.|.:     ..|..|..|:|.||  .||.|:.:..||    
  Fly   242 IQYKAKVIYAPPEVFLPYGQPAVLDCHF-----RANPPLKNLRWEKD--GLLFDSYNVPGVFYKM 299

Human   178 KDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVD-LG 241
            ...|....|.|.|.|:||| ..|..||...| :.||..|.|      ||.|.|...:.:.:. ||
  Fly   300 NGSLFFAKVDENHAGSYTC-TPYNDLGTDGP-SPVISVIVL------RPPIFSVTPKAIYIQKLG 356

Human   242 SQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSV------ENPANKRRSTL----ITVL 296
            ...:|.|                ..||.|    |.:..|:      ..|....|.:|    :|:.
  Fly   357 EAAELPC----------------EAIDRD----GNNRPSIIWGRKDGQPLPADRFSLSGGNLTIT 401

Human   297 NISEIESRFYKHPFTCFAKNTHGIDAAYIQL----IYPVT--NFQKHMIGICVTLTVIIVCSVFI 355
            .:.|.:...|:    |.|.|......|..:|    |.|..  |...:....|:|          |
  Fly   402 GLVEGDRGIYE----CSATNEAATITAEAELMIENIAPRAPYNLTANSTETCIT----------I 452

Human   356 -----YKIFKIDIVLWYR-DSCYDFLPIKASD-------------GKTYDAYILYPKTVGEGSTS 401
                 |....::..:||| ....::..::..|             ||.|:..:|.....|:|..|
  Fly   453 RWQPGYLRPNLEYTVWYRLMEAPEWRTLRVLDKKVMEATVQHLQPGKEYEFMVLSQDKYGDGMFS 517

Human   402 DCDIFVFKVLP 412
              ..|.|:.||
  Fly   518 --KQFRFQTLP 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IL1R1NP_000868.1 Ig1_IL1R_like 24..113 CDD:319308 15/57 (26%)
Ig2_IL1R_like 128..219 CDD:319309 30/97 (31%)
IG 234..328 CDD:214652 20/108 (19%)
TIR 384..540 CDD:214587 9/29 (31%)
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 16/64 (25%)
Ig 157..242 CDD:299845 16/64 (25%)
Ig_2 252..337 CDD:290606 29/93 (31%)
IG_like 260..327 CDD:214653 24/74 (32%)
I-set 341..428 CDD:254352 21/110 (19%)
IGc2 356..419 CDD:197706 17/86 (20%)
FN3 435..524 CDD:238020 19/100 (19%)
FN3 554..636 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.