Sequence 1: | NP_000868.1 | Gene: | IL1R1 / 3554 | HGNCID: | 5993 | Length: | 569 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001346715.1 | Gene: | ttn-1 / 266969 | WormBaseID: | WBGene00006436 | Length: | 15188 | Species: | Caenorhabditis elegans |
Alignment Length: | 324 | Identity: | 75/324 - (23%) |
---|---|---|---|
Similarity: | 132/324 - (40%) | Gaps: | 67/324 - (20%) |
- Green bases have known domain annotations that are detailed below.
Human 22 KCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIH----QHKEKLW 82
Human 83 FVPAKVEDSGHYYCVVRN------SSYCLRIK--IS--AKFVENEPNLCYNAQAIFKQKLPVAGD 137
Human 138 GGLVC-----PYMEFFKNENNELPKLQWYKDCKPLLLDN---IHFSGVKDRLIVMNVAEKHRGNY 194
Human 195 TCHASYTY-LGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQ-LSDI 257
Human 258 AYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGID 321 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
IL1R1 | NP_000868.1 | Ig1_IL1R_like | 24..113 | CDD:319308 | 26/102 (25%) |
Ig2_IL1R_like | 128..219 | CDD:319309 | 22/99 (22%) | ||
IG | 234..328 | CDD:214652 | 20/89 (22%) | ||
TIR | 384..540 | CDD:214587 | |||
ttn-1 | NP_001346715.1 | IG | 105..177 | CDD:214652 | |
I-set | 205..285 | CDD:333254 | |||
I-set | 406..493 | CDD:333254 | |||
I-set | 821..914 | CDD:333254 | |||
Ig | 962..1032 | CDD:319273 | |||
I-set | 1135..1215 | CDD:333254 | |||
I-set | 1679..1767 | CDD:254352 | |||
Ig | 1789..>1845 | CDD:319273 | |||
Atrophin-1 | <1957..2285 | CDD:331285 | |||
I-set | 2381..2468 | CDD:333254 | |||
I-set | 2489..2578 | CDD:333254 | |||
I-set | 2631..2717 | CDD:333254 | |||
I-set | 2732..2815 | CDD:333254 | |||
Ig | 2848..2909 | CDD:319273 | |||
I-set | 2924..3007 | CDD:333254 | |||
RNase_E_G | <3161..3303 | CDD:331378 | |||
RNase_E_G | <3356..3556 | CDD:331378 | |||
RNase_E_G | <3506..3673 | CDD:331378 | |||
RNase_E_G | <3595..3803 | CDD:331378 | |||
RNase_E_G | <3722..3912 | CDD:331378 | |||
RNase_E_G | <3875..4073 | CDD:331378 | |||
FtsK | <4014..>4556 | CDD:332908 | |||
RNase_E_G | <4346..4567 | CDD:331378 | |||
RNase_E_G | <4525..4723 | CDD:331378 | |||
RNase_E_G | <4746..4936 | CDD:331378 | |||
RNase_E_G | <4858..5044 | CDD:331378 | |||
FtsK | <4960..>5541 | CDD:332908 | |||
Neuromodulin_N | <5525..6250 | CDD:331332 | |||
Neuromodulin_N | <6198..6681 | CDD:331332 | |||
V-ATPase_G_2 | <6559..>6683 | CDD:330366 | |||
I-set | 7448..7535 | CDD:333254 | |||
FN3 | 7540..7630 | CDD:238020 | |||
MDN1 | <7687..8197 | CDD:331582 | |||
Neuromodulin_N | <7944..8780 | CDD:331332 | |||
Ig | 8886..>8935 | CDD:325142 | |||
FN3 | 9052..9142 | CDD:238020 | |||
Neuromodulin_N | <9210..9875 | CDD:331332 | |||
Neuromodulin_N | <9583..10392 | CDD:331332 | |||
IG_like | 10597..>10662 | CDD:214653 | |||
Ig | 10711..10773 | CDD:325142 | |||
FN3 | 10777..10870 | CDD:238020 | |||
FN3 | 10883..10958 | CDD:238020 | |||
FN3 | 10984..11070 | CDD:238020 | |||
I-set | 11077..11165 | CDD:333254 | |||
IG | 11179..11259 | CDD:214652 | |||
I-set | 11264..11350 | CDD:333254 | |||
I-set | 11368..11446 | CDD:333254 | |||
FN3 | 11450..11543 | CDD:238020 | |||
FN3 | 11565..11645 | CDD:238020 | |||
I-set | 11823..11903 | CDD:333254 | |||
I-set | 11918..11996 | CDD:333254 | |||
FN3 | 12006..12097 | CDD:238020 | |||
FN3 | 12131..12217 | CDD:238020 | |||
I-set | 12225..12313 | CDD:333254 | |||
Ig | 12337..12411 | CDD:325142 | |||
FN3 | 12415..12503 | CDD:238020 | |||
PKc_like | 12566..12815 | CDD:328722 | |||
I-set | 12894..12985 | CDD:254352 | |||
I-set | 13024..13114 | CDD:333254 | |||
I-set | 13123..13206 | CDD:254352 | 24/86 (28%) | ||
Ig | 13249..13314 | CDD:319273 | 19/76 (25%) | ||
I-set | 13331..13421 | CDD:254352 | 22/97 (23%) | ||
I-set | 13456..13545 | CDD:254352 | |||
I-set | 13558..13650 | CDD:254352 | |||
I-set | 13663..13753 | CDD:254352 | |||
FN3 | 13778..13864 | CDD:238020 | |||
Ig | 13893..13963 | CDD:325142 | |||
I-set | 13984..14074 | CDD:333254 | |||
I-set | 14083..14168 | CDD:254352 | |||
Ig_3 | 14195..14275 | CDD:316449 | |||
Ig_3 | 14302..14384 | CDD:316449 | |||
I-set | 14408..14498 | CDD:333254 | |||
I-set | 14634..14724 | CDD:333254 | |||
IG_like | 14754..14838 | CDD:214653 | |||
I-set | 14854..14943 | CDD:333254 | |||
I-set | 14969..15044 | CDD:254352 | |||
Ig_3 | 15054..15132 | CDD:316449 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |