DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-5 and ZMYND15

DIOPT Version :9

Sequence 1:NP_610202.3 Gene:SmydA-5 / 35538 FlyBaseID:FBgn0033061 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001254751.1 Gene:ZMYND15 / 84225 HGNCID:20997 Length:750 Species:Homo sapiens


Alignment Length:396 Identity:84/396 - (21%)
Similarity:115/396 - (29%) Gaps:157/396 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 CRLGKHQCRR-----CRW-----PVCSAGCKHESMECSVLSLGSGS-----PTRADARSLNDYFR 152
            ||..:.|.||     ..|     |..|.|          :|||.|:     |....|..|.|.  
Human    40 CRQLEAQIRRLPQDPALWVLHVLPNHSVG----------ISLGQGAEPGPGPGLGTAWLLGDN-- 92

  Fly   153 GDALLVLKCLLLQRQSPTKWSALLEMQSHEEERKGTDLYEEAEKR---------VVTYLQKRFLC 208
                   ..|.|:..||  :.:.:.::..||..:..:..||.|||         .|...:.|.|.
Human    93 -------PPLHLRDLSP--YISFVSLEDGEEGEEEEEEDEEEEKREDGGAGSTEKVEPEEDRELA 148

  Fly   209 RLKQTNPNLLTDCGPEMLHRLCGIIETNFMVIELPSGVELSGLFRQACMMEHACQPNCDFQFDNK 273
            ...:.:|.                 |||      |.| |.....|:|...:..|:.:   :.:|:
Human   149 PTSRESPQ-----------------ETN------PPG-ESEEAAREAGGGKDGCRED---RVENE 186

  Fly   274 TQQVAVRAGCDLRKGDHLRITYTNILWGTQLRQHHLRLTKHFSCRCSRCLDPTEYGTYISALTCL 338
            |:.       ..|||                 |.......|.||   ..|...|:||.:      
Human   187 TRP-------QKRKG-----------------QRSEAAPLHVSC---LLLVTDEHGTIL------ 218

  Fly   339 GDVNQTCGGTHLPVDPLDENTQWKCDT----------------CPM------------IVDGAYV 375
                    |..|.||.......|...|                |||            :.|....
Human   219 --------GIDLLVDGAQGTASWGSGTKDLAPWAYALLCHSMACPMGSGDPRKPRQLTVGDARLH 275

  Fly   376 AELQSHMTEQVEGLLAGCPSAN-------QVELLLARLTHMLHPNHFHTFNLKHT-----LIQLY 428
            .||:| :..::...||..|...       ....|.||..|:.|.   |:|..|.|     ...||
Human   276 RELES-LVPRLGVKLAKTPMRTWGPRPGFTFASLRARTCHVCHR---HSFEAKLTPCPQCSAVLY 336

  Fly   429 GNEAGL 434
            ..||.|
Human   337 CGEACL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-5NP_610202.3 zf-MYND 7..43 CDD:280009
SET 185..295 CDD:279228 23/118 (19%)
ZMYND15NP_001254751.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..199 26/140 (19%)
zf-MYND 313..359 CDD:280009 11/33 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 565..590
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 709..750
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148803
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.