DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-5 and ASHR2

DIOPT Version :9

Sequence 1:NP_610202.3 Gene:SmydA-5 / 35538 FlyBaseID:FBgn0033061 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_849991.1 Gene:ASHR2 / 816483 AraportID:AT2G19640 Length:398 Species:Arabidopsis thaliana


Alignment Length:286 Identity:69/286 - (24%)
Similarity:107/286 - (37%) Gaps:29/286 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GRYLKVTQNIAAGQIVFIEEPLVVGPKWYLSDADKEASNVP-CVGCYTPCRLGKHQ-CRRCRW-P 116
            ||.|...|::.|||::..|.||::    |.:.....:|..| |..|:.......|| |:.|.. .
plant    22 GRSLVAAQSLRAGQVILRESPLLL----YSAFPFLSSSVSPYCDHCFRLLASSAHQKCQSCSLVS 82

  Fly   117 VCSAGC--KHESMECSVLSLGSGSPTRADARSLNDYFRGDALLVLKCLLLQRQSPTKWSALLEMQ 179
            .||..|  .|....|..|.....|.:.|.:...:|. :..|..:|....|...||:.:..||.:|
plant    83 FCSPNCFASHTPWLCESLRRLHQSSSSAFSDQPSDR-QVQARFLLSAYNLAAASPSDFQILLSLQ 146

  Fly   180 SHEEERKGTDLYEEAEKRVVTYLQKRFLCRLKQTNPNLLTDCGPEMLHRLCGIIETN-FMVIELP 243
            . .....|.......:.....:|..    .|....|:|.....|::...|....:.| |.::|..
plant   147 G-SGSSNGDPSCSAGDSAAAGFLHS----LLSSVCPSLPVSISPDLTAALLSKDKVNAFGLMEPC 206

  Fly   244 S------GVELSGLFRQACMMEHACQPN-CDFQF-----DNKTQQVAVRAGCDLRKGDHLRITYT 296
            |      .|...|::.:.....|.|.|| |.|.:     |..| .:.:|...|:.:|..:.::|.
plant   207 SVSNEKRSVRAYGIYPKTSFFNHDCLPNACRFDYVDSASDGNT-DIIIRMIHDVPEGREVCLSYF 270

  Fly   297 NILWGTQLRQHHLRLTKHFSCRCSRC 322
            .:......||..|.....|.|.|.||
plant   271 PVNMNYSSRQKRLLEDYGFKCDCDRC 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-5NP_610202.3 zf-MYND 7..43 CDD:280009
SET 185..295 CDD:279228 24/122 (20%)
ASHR2NP_849991.1 SET <192..275 CDD:214614 18/83 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.