powered by:
Protein Alignment SmydA-5 and ANKMY2
DIOPT Version :9
Sequence 1: | NP_610202.3 |
Gene: | SmydA-5 / 35538 |
FlyBaseID: | FBgn0033061 |
Length: | 553 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_064715.1 |
Gene: | ANKMY2 / 57037 |
HGNCID: | 25370 |
Length: | 441 |
Species: | Homo sapiens |
Alignment Length: | 61 |
Identity: | 24/61 - (39%) |
Similarity: | 33/61 - (54%) |
Gaps: | 4/61 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 CPVCG-VAASQACTRCKMVRYCDREHQKQHWPQHKRRCRPFS---EEQDAELGRYLKVTQN 63
|..|| ..||:.|:.||||.|||:..||.||..||:.|:... |:|..|..:..:..:|
Human 320 CTTCGEKGASKRCSVCKMVIYCDQTCQKTHWFTHKKICKNLKDIYEKQQLEAAKEKRQEEN 380
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S5123 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.