DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-5 and smyd3

DIOPT Version :9

Sequence 1:NP_610202.3 Gene:SmydA-5 / 35538 FlyBaseID:FBgn0033061 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001032477.1 Gene:smyd3 / 569507 ZFINID:ZDB-GENE-051120-138 Length:380 Species:Danio rerio


Alignment Length:351 Identity:73/351 - (20%)
Similarity:106/351 - (30%) Gaps:170/351 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TECPVC---GVAASQACTRCKMVRYCDREHQKQHWPQHKRRCRPFSEEQDAELGRYLKVTQNIAA 66
            |.|..|   |.:.|: |::||..|||:.:.|||.||.|||.|:                      
Zfish    47 TACQSCLKRGESLSR-CSQCKTARYCNVQCQKQAWPDHKRECK---------------------- 88

  Fly    67 GQIVFIEEPLVVGPKWYLSDADKEASNVPCVGCYTPCRLGKHQCRRCRWPVCSAGCKHESMECSV 131
                                         |:                         ||       
Zfish    89 -----------------------------CL-------------------------KH------- 92

  Fly   132 LSLGSGSPTRADARSLNDYFRGDALLVLKCLLLQRQSPTKWSALLEMQSH-----EEERKGTDLY 191
              |....||        |..|..|.::.|.|........:..::.|.|||     ||:.:|.   
Zfish    93 --LQPRIPT--------DSVRLVARIIFKLLSQSESDQEELYSIAEHQSHLADMSEEKTEGL--- 144

  Fly   192 EEAEKRVVTYLQKRFLCRLKQTNPNLLTDCGPEMLHRLCGIIETNFMVIELPSGV---------- 246
                |.:.|.||                          ..:.|.|..:..||||:          
Zfish   145 ----KHLCTTLQ--------------------------VYLAEENCDLSRLPSGLDPVSLLARVT 179

  Fly   247 ---------ELS----GLFRQACMMEHACQPNCDFQFDNKTQQVAVRAGCDLRKGDHLRITYTNI 298
                     ||.    ||:....::.|.|||||...|:.|  ::.:||...:|..:.|.|:||:|
Zfish   180 CNCFSISDGELQDVGVGLYPSMSLLNHDCQPNCIMMFEGK--RLTLRAVRVIRSAEELTISYTDI 242

  Fly   299 L----------WGTQLRQHHLRLTKH 314
            |          |...|::....|.:|
Zfish   243 LAPSKDRRSQHWDELLKESQALLHRH 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-5NP_610202.3 zf-MYND 7..43 CDD:280009 18/38 (47%)
SET 185..295 CDD:279228 28/132 (21%)
smyd3NP_001032477.1 zf-MYND 49..87 CDD:280009 18/38 (47%)
SET <201..239 CDD:279228 13/39 (33%)
TPR_12 276..351 CDD:290160
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582757
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2289
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.