DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-5 and smyd1b

DIOPT Version :9

Sequence 1:NP_610202.3 Gene:SmydA-5 / 35538 FlyBaseID:FBgn0033061 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001034725.1 Gene:smyd1b / 569027 ZFINID:ZDB-GENE-060522-1 Length:486 Species:Danio rerio


Alignment Length:383 Identity:80/383 - (20%)
Similarity:146/383 - (38%) Gaps:100/383 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GRYLKVTQNIAAGQIVFIEEPL--VVGPKWYLSDADKEASNVPCVGCYTPCRLGKHQ-CRRCRW- 115
            ||.|:.|:...||.::|.|.|.  ||        .|.:||:: |..|:.  |..|.| |.:||: 
Zfish    13 GRGLRATKEAWAGDVLFAEPPFASVV--------FDSQASSI-CHSCFR--RQEKLQRCGQCRFA 66

  Fly   116 ----PVCS-AGCKHESMECSVLSLGSGSPTRADARSLNDYFRGDALLVLKCLLLQRQ-------S 168
                ..|. ||.:...:||:.:.. .|.|...:.|             |...:|.|.       |
Zfish    67 QYCDKTCQRAGWEEHKLECAAIKT-YGKPPSENVR-------------LAARILWRMDKQGSVVS 117

  Fly   169 PTKWSALLEMQSH-----EEERKG--TDLYEEAEKRVVTYLQKRFLCRLKQTNPNLLTDCGPEML 226
            ..:.:.|.:::.|     |::.|.  .|::     ..:.|..       :.:.|:.:     :.:
Zfish   118 DNQLTTLEDLEDHICDISEDDLKDFKVDIH-----NFLDYWP-------RNSKPHTV-----DSV 165

  Fly   227 HRLCGIIETNFMVIELPSGVEL--SGLFRQACMMEHACQPNCDFQFDNKTQ-----------QVA 278
            ..:.|:|..|..::....|::.  .|||...|::.|.|.|||....:|..|           ::.
Zfish   166 SHILGVINCNGFMVSDQRGLQAVGVGLFPNLCLVNHDCWPNCTVILNNGNQSAIDTVFHSQKRIE 230

  Fly   279 VRAGCDLRKGDHLRITYTNILWGTQLRQHHLRLTKHFSCRCSRCLDPTEYGTYISALTCLGDVNQ 343
            :||...:..|:.:.:.|.:.|..:..||..|:....|.|.|..|.:.            :.|..:
Zfish   231 LRALGKISAGEEVTVAYVDYLNVSADRQRLLKQQYFFDCTCKHCTEK------------IKDDLK 283

  Fly   344 TCG----GTHLPVDPLDENTQW------KCDTCPMIVDGAYVAELQSHMTEQVEGLLA 391
            ..|    |..:|.:.:.|.|::      |.:...:..:...|.::.....|:.|.:||
Zfish   284 MAGAEVDGVKVPEEQVKEVTEFSRQKLEKMEKARIEANYNEVVKICRECVEKQENVLA 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-5NP_610202.3 zf-MYND 7..43 CDD:280009
SET 185..295 CDD:279228 22/124 (18%)
smyd1bNP_001034725.1 zf-MYND 47..85 CDD:280009 11/39 (28%)
SET <173..247 CDD:214614 16/73 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582767
Domainoid 1 1.000 54 1.000 Domainoid score I11197
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.