DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-5 and Smyd5

DIOPT Version :9

Sequence 1:NP_610202.3 Gene:SmydA-5 / 35538 FlyBaseID:FBgn0033061 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_650955.1 Gene:Smyd5 / 42517 FlyBaseID:FBgn0038869 Length:393 Species:Drosophila melanogaster


Alignment Length:374 Identity:79/374 - (21%)
Similarity:133/374 - (35%) Gaps:115/374 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GRYLKVTQNIAAGQIVFIEEPLVVGP-KWYLSDADKEASNVPCVGCYTPCR-------------- 104
            ||.:..|:|.|..:::|.|||.|... .|.::     .....|..|..|..              
  Fly    13 GRAMIATKNFAKDEVIFEEEPFVSRQFSWNVA-----YGYAACDHCMRPLETVLENVRRLASDPK 72

  Fly   105 ----LGKH-----------QCRRCRWPVCSAGCKHESME--CSVLSLGS-GSPTRADARSLNDYF 151
                |.:|           ||.||:...||..|..|:.:  ..|..:|: .|........||:.:
  Fly    73 VEVPLLQHDPTAQWVAQFTQCPRCKVRYCSEDCLMEAQKRYHRVACMGAFHSDDTHPINVLNETW 137

  Fly   152 R--------GDALLVLKCLLLQRQSPTKWSALLEMQSHEEERKGTDLYEEAEKRVV-TYLQKRFL 207
            :        |..:|:::.:.|.:||..|...|.::||.:      .|....|:::. ..|.:.|.
  Fly   138 KKMHYPPETGSIMLIVRLMALYQQSTKKEEFLEQLQSFQ------SLIVNREQKIYHKMLGENFE 196

  Fly   208 CRLKQTNPNLLTDCG------------PEMLHRLCGIIETNFM-------------VIELP---- 243
            .:::|.   .|..|.            |:....|..|:.||..             |.:||    
  Fly   197 QQMEQL---YLAFCNAFTGEEFSIFKTPDAFKTLMAILGTNSQGIATSVLSQWVAKVSDLPLTDS 258

  Fly   244 ---------SGV--------------ELSGLFRQACMMEHACQPNCDFQFDNKTQQVAVRAGCDL 285
                     .|:              |.|||:.....:.|:|.||....|......|.::|...:
  Fly   259 EKEQLDTVIDGLYAKVGEFAGEFLNNEGSGLYLLQSKINHSCVPNACSTFPYSNDIVVLKALAPI 323

  Fly   286 RKGDHLRITYTN--ILWGTQLRQHH-LRLTKHFSCRCSRC----LDPTE 327
            ::|:.:.|:|.:  :|..::..:|. ||....|.|:|.:|    .||.|
  Fly   324 QQGEEICISYLDECMLERSRHSRHKVLRENYVFICQCPKCRAQASDPDE 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-5NP_610202.3 zf-MYND 7..43 CDD:280009
SET 185..295 CDD:279228 29/162 (18%)
Smyd5NP_650955.1 zf-MYND 87..118 CDD:280009 9/30 (30%)
SET <296..333 CDD:279228 9/36 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452048
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.