DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-5 and Smyd4-2

DIOPT Version :9

Sequence 1:NP_610202.3 Gene:SmydA-5 / 35538 FlyBaseID:FBgn0033061 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_648574.1 Gene:Smyd4-2 / 39414 FlyBaseID:FBgn0036282 Length:663 Species:Drosophila melanogaster


Alignment Length:384 Identity:80/384 - (20%)
Similarity:117/384 - (30%) Gaps:120/384 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PVCGVAASQACTR-CKMVRYCDREHQKQHWPQHKRRCRPFSEEQDAEL---------------GR 56
            |.|.......|.: ...|:...:|...:..||       .:..:.|||               ||
  Fly   209 PGCDATHIALCRKELSSVKPKPKEATSEQVPQ-------LAHGESAELVGASKVVRLVETKDKGR 266

  Fly    57 YLKVTQNIAAGQIVFIEEPLVVGPKWYLSDADKEASNVPCVGCYTPCRLGKHQCRRC----RWPV 117
            ::...:.:..|.::..|||:                    ..|..|...|.| |..|    ..||
  Fly   267 FVVANEGLRTGDVLLFEEPV--------------------AACLEPSYFGTH-CHHCFKRLHTPV 310

  Fly   118 ----------CSAGCKHES------MECSVLSLGSGSPTRADARSLNDYFRGDALLVLKCLLLQR 166
                      |||.|..|:      .||..:.|..||              |.::|....|.:..
  Fly   311 SCLHCSGIAFCSAQCMGEACSSYHRFECEYMDLMIGS--------------GMSILCFIALRIFT 361

  Fly   167 QSPTKWSALL-------EMQSHEEERKGTDLYEEAEKRVVTYLQKRFLCRLKQ------------ 212
            |:|:....|.       .:.||||:|:..|....|       |...||.|:.|            
  Fly   362 QAPSLEQGLATANLLFEHLCSHEEDRQPDDYLRRA-------LMSGFLLRILQKSLYFGRRKTEG 419

  Fly   213 TNPNLLTDCGPEMLHRLCGIIETNFMVIELPSGVE------------LSGLFRQACMMEHACQPN 265
            .||..:.......|..|..:::.|...|......|            .:||:.......|.|.|:
  Fly   420 VNPTAVELQVATALLGLLQVLQYNAHQIYQTQVTEEHRFDGSKTVYLAAGLYGTGSYFNHECWPS 484

  Fly   266 CDFQFDNKTQQVAVRAGCDLRKGDHLRITYTNILWGTQL--RQHHLRLTKHFSCRCSRC 322
            ....|..|  ::.:.|....|..:.:.:.|..|.....|  ||..||....|||.|..|
  Fly   485 TACHFVGK--KLVLTATRPHRANELVAVNYGPIFIKNNLKERQRSLRGRYSFSCSCMAC 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-5NP_610202.3 zf-MYND 7..43 CDD:280009 7/35 (20%)
SET 185..295 CDD:279228 24/133 (18%)
Smyd4-2NP_648574.1 TPR_11 142..205 CDD:290150
zf-MYND 299..338 CDD:280009 9/38 (24%)
SET <474..513 CDD:279228 7/40 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452060
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.