DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-5 and pdcd2

DIOPT Version :9

Sequence 1:NP_610202.3 Gene:SmydA-5 / 35538 FlyBaseID:FBgn0033061 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001038603.1 Gene:pdcd2 / 393370 ZFINID:ZDB-GENE-040426-1236 Length:358 Species:Danio rerio


Alignment Length:88 Identity:28/88 - (31%)
Similarity:42/88 - (47%) Gaps:11/88 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CPVCGVAASQACTRCKMVRYCDREHQKQHWPQ-HKRRCRPFSEEQDAELGRYLKVTQNIAAGQIV 70
            |.:||....:||:||..|.||.:|||...|.| ||:.|...:.:...||..:|.....:      
Zfish   145 CRLCGCLGQKACSRCHSVTYCCKEHQTTDWKQRHKKECLAEASQVSGELNSFLFPEWEL------ 203

  Fly    71 FIEEPLVVGPKWYLSDA---DKE 90
             :.||.|:..|..|.::   |:|
Zfish   204 -VTEPEVIPAKDELQESPSLDQE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-5NP_610202.3 zf-MYND 7..43 CDD:280009 17/36 (47%)
SET 185..295 CDD:279228
pdcd2NP_001038603.1 zf-MYND 145..182 CDD:280009 17/36 (47%)
PDCD2_C 238..351 CDD:282100
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.