DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-5 and pdcd2

DIOPT Version :10

Sequence 1:NP_610202.3 Gene:SmydA-5 / 35538 FlyBaseID:FBgn0033061 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001038603.2 Gene:pdcd2 / 393370 ZFINID:ZDB-GENE-040426-1236 Length:358 Species:Danio rerio


Alignment Length:88 Identity:28/88 - (31%)
Similarity:42/88 - (47%) Gaps:11/88 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CPVCGVAASQACTRCKMVRYCDREHQKQHWPQ-HKRRCRPFSEEQDAELGRYLKVTQNIAAGQIV 70
            |.:||....:||:||..|.||.:|||...|.| ||:.|...:.:...||..:|.....:      
Zfish   145 CRLCGCLGQKACSRCHSVTYCCKEHQTTDWKQRHKKECLAEASQVSGELNSFLFPEWEL------ 203

  Fly    71 FIEEPLVVGPKWYLSDA---DKE 90
             :.||.|:..|..|.::   |:|
Zfish   204 -VTEPEVIPAKDELQESPSLDQE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-5NP_610202.3 zf-MYND 7..43 CDD:460312 17/36 (47%)
SET_SMYD <232..322 CDD:380997
pdcd2NP_001038603.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.