DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-5 and Smyd4-4

DIOPT Version :9

Sequence 1:NP_610202.3 Gene:SmydA-5 / 35538 FlyBaseID:FBgn0033061 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_610730.1 Gene:Smyd4-4 / 36299 FlyBaseID:FBgn0027495 Length:573 Species:Drosophila melanogaster


Alignment Length:390 Identity:76/390 - (19%)
Similarity:126/390 - (32%) Gaps:137/390 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QDAELGRYLKVTQNIAAGQIVFIEEPL---VVGPKWYLSDADKEASN----VPCVGCYTPCRLGK 107
            :.|..||::...:::|.|.:|.:|||.   ::.|..|:..|..:..|    :||..|        
  Fly   191 ETAAEGRFVVTNRDLAVGDLVSVEEPFCSTLLTPMRYIRCATCKRENYLTLIPCDSC-------- 247

  Fly   108 HQCRRCRWPVCSAGCKHESM------ECSVLSLGSGSPTRADARSLNDYFRGDALLVLKCLLL-- 164
                 |....||..||..:|      ||.::..            ||..|.....:.|:..|:  
  Fly   248 -----CSTMFCSEECKSIAMQTYHRYECPIIDF------------LNRMFNKIHCIALRTTLVAL 295

  Fly   165 --------------QRQSPTK---------------WSALLEMQSHEEERKGTDLYEEAEKRVVT 200
                          |.|:..|               :.|:..:.:::..|..:||:   ::.||.
  Fly   296 NIFPSIEELIDFCEQEQNQDKCAFDLNYNELTPEEHYRAIHGLVTNQHLRSVSDLF---QRSVVC 357

  Fly   201 YLQKRFLCRLK--------QTNPNLLTDCGPEMLHRLCGIIETNFMVIELPSGV--------ELS 249
            .:.|.|:....        :...|..||    :|.|......:|...|:|...|        ..|
  Fly   358 AVLKHFIIEYTPVKEYLGGEEGVNFFTD----LLFRHLQTSPSNMHGIDLVEQVNETKDDQTHSS 418

  Fly   250 GLFRQACMMEHACQPNCDFQFD-NKTQQVAVRAGCDLRKGDHLRITYTN-----ILWGTQLRQHH 308
            |.:....::.|:|.||....:: .|.....:|   .::.|:   :.|.|     .:...:.|...
  Fly   419 GAYAFLSLINHSCAPNTVRIYEGTKAYMFVLR---PIKAGN---VLYDNYGAHFAICSKEQRLKR 477

  Fly   309 LRLTKHFSCRCSRC-------------------LDPTE--------------YGTYISALTCLGD 340
            |.|...|.|:|..|                   .|.||              |..|...||..||
  Fly   478 LSLQYRFDCKCEGCELNYPMFGMMPHKATVPSVTDDTELALSSYNYDFAVSNYRKYCDFLTQYGD 542

  Fly   341  340
              Fly   543  542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-5NP_610202.3 zf-MYND 7..43 CDD:280009
SET 185..295 CDD:279228 25/126 (20%)
Smyd4-4NP_610730.1 TPR_11 67..138 CDD:290150
zf-MYND 230..270 CDD:280009 11/52 (21%)
SET 363..463 CDD:279228 21/109 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.