DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-5 and dao

DIOPT Version :9

Sequence 1:NP_610202.3 Gene:SmydA-5 / 35538 FlyBaseID:FBgn0033061 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001260462.1 Gene:dao / 34891 FlyBaseID:FBgn0028862 Length:882 Species:Drosophila melanogaster


Alignment Length:559 Identity:109/559 - (19%)
Similarity:175/559 - (31%) Gaps:212/559 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LKVTQNIAAGQIVFIEEPLVVGPKWYLSDAD----KEASNVPCVGCYTPCRLGKHQCRRCRWPVC 118
            |..|:.:|...::|..|.:.:.|.......|    .:....||:.|..  ||..:..|:||:   
  Fly   326 LHTTRAVAKNALIFESEAVAMVPSGNCRVCDYCGITQFIPFPCIYCSN--RLVVYCSRQCRF--- 385

  Fly   119 SAGCKH---ESMEC------SVLSLGS--GSPTRADARSLNDYFRGDALLV--LKCLL------- 163
                ||   .::||      ...|.|.  |.|     |.|...||   :|:  |..||       
  Fly   386 ----KHAAIHAVECFGHQIELFESFGEVFGMP-----RLLQLAFR---MLITGLPELLGHCRKKP 438

  Fly   164 ------------LQRQSPTKWSALLEMQSHEEER--------------------KGTDLYEEAEK 196
                        ||.:....:||:|.::..:|||                    |.|..:::.||
  Fly   439 TLSKLWSAINGGLQERQDIAYSAVLRLERLKEERPTDTVIALALAAHILSIYLSKCTTFFDQLEK 503

  Fly   197 RVVT-----YLQKRFLC------RLKQTNPNLLTDCGPEMLHRLCGIIETNFMVIELPSGVELSG 250
            .:.|     ..:...||      .:.|.....||.|             .:|:   ||:.     
  Fly   504 SLPTASRMSSAEWELLCAALLMRHIGQLRHRSLTAC-------------RSFV---LPAD----- 547

  Fly   251 LFRQACMMEHACQPNCDFQFDNKTQQVAVRAGCDLRKGDHLRITYTNILWGT--QLRQHHLRL-- 311
                    .|...|..:||                             ||..  :|::.||.|  
  Fly   548 --------PHVFSPLNEFQ-----------------------------LWAAPMRLQEGHLHLLA 575

  Fly   312 ----TKHFS--------CR--CSRCLDPTEYGTYISALTCL------GDVNQTCGGT--HLPVDP 354
                ...:|        ||  ||..:.....|..::||..|      |..|...||.  .||.:.
  Fly   576 GEVAVVSYSVYPDTLNLCRHSCSSTICAKFSGRTVTALALLDLPAGSGIYNCFAGGNFQQLPREE 640

  Fly   355 -----LDENTQWKCDTCPMIVDGAYVAELQSHMTEQVEGL-LAGCPSANQVELLLARLTHMLHPN 413
                 |:...:..|:.|.:           :|..:|.... ...|.:.|.:|:..        ||
  Fly   641 RTKQLLESGIRCHCNACQL-----------THSDDQFHKFHRYRCDNPNCMEIFT--------PN 686

  Fly   414 HF-HTFNLKHTLIQLYGNEA--GLELGVLSNTQLERKLRLCGELYNVCRRLDPYSIKLAIYVTVI 475
            .. |..:|:..|.:.|....  |.:|.:..:         |||.    ::|:.:.......:...
  Fly   687 ALPHAPSLRWWLSEEYTQPEFNGADLIMCPH---------CGEY----QKLEWFWAFTTSLIDCE 738

  Fly   476 LIEVAHTLQEQARRAPAEGTSLLGLAQSRLREAHMVLEK 514
            |||....|.....||.   ..|:.|.:.::..|.::||:
  Fly   739 LIEERCKLYAAIERAE---NQLMDLHECKVALARLLLEQ 774

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-5NP_610202.3 zf-MYND 7..43 CDD:280009
SET 185..295 CDD:279228 19/140 (14%)
daoNP_001260462.1 TPR_11 165..235 CDD:290150
TPR repeat 200..235 CDD:276809
TPR repeat 243..270 CDD:276809
zf-MYND 355..395 CDD:280009 11/48 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473065
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.