DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-5 and Smyd1

DIOPT Version :9

Sequence 1:NP_610202.3 Gene:SmydA-5 / 35538 FlyBaseID:FBgn0033061 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001100065.1 Gene:Smyd1 / 297333 RGDID:1305105 Length:490 Species:Rattus norvegicus


Alignment Length:377 Identity:84/377 - (22%)
Similarity:143/377 - (37%) Gaps:90/377 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GRYLKVTQNIAAGQIVFIEEPLVVGPKWYLSDADKEASNVPCVGCY-TPCRLGKHQCRRCRWP-V 117
            ||.||.|:...|..::|.|       :.|.:.......|..|..|: ...||  |:|.:|::. .
  Rat    18 GRGLKATKEFWAADVIFAE-------RAYSAVVFDSLINFVCHTCFKRQERL--HRCGQCKFAHY 73

  Fly   118 CSAGCKHESM-----ECSVLSLGSGSPT---RADARSLNDYFRGDALLVLKCLLLQRQSPTKWSA 174
            |...|:.::.     |||.:......|.   |..||.:....|....|...||:          :
  Rat    74 CDRTCQKDAWLNHKNECSAIKRYGKVPNENIRLAARIMWRVEREGTGLTEGCLV----------S 128

  Fly   175 LLEMQSH-----EEERKGTDLYEEAEKRVVTYLQKRFLCRLKQTNPNLLTDCGPEMLHRLCGIIE 234
            :.::|:|     |||:|      |....|.|:||..         |........:.:..:.|:|.
  Rat   129 VDDLQNHVEHFGEEEQK------ELRVDVDTFLQYW---------PPQSQQFSMQYISHIFGVIN 178

  Fly   235 TNFMVIELPSGVEL--SGLFRQACMMEHACQPNCDFQFDN----------KTQ-QVAVRAGCDLR 286
            .|...:....|::.  .|:|....::.|.|.|||...|:|          .|| ::.:||...:.
  Rat   179 CNGFTLSDQRGLQAVGVGIFPNLGLVNHDCWPNCTVIFNNGNHEAVKSMFHTQMRIELRALGKIS 243

  Fly   287 KGDHLRITYTNILWGTQLRQHHLRLTKHFSCRCSRCLDPTEYGTYISALTCLGDVNQTCGGTHLP 351
            :|:.|.::|.:.|..::.|:..|:...:|.|.|..|....:...:::                :.
  Rat   244 EGEELTVSYIDFLHLSEERRQQLKKQYYFDCSCEHCQKGLKDDLFLA----------------VK 292

  Fly   352 VDP------LDENTQWKCDTCPMI----VDGAY--VAELQSHMTEQVEGLLA 391
            .||      :.|.||:..||...|    .:|.|  |.:|.....|:.|.:.|
  Rat   293 EDPKPSQEVVKEMTQFSKDTLEKIDKARSEGLYHEVVKLCRECLEKQEPVFA 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-5NP_610202.3 zf-MYND 7..43 CDD:280009
SET 185..295 CDD:279228 26/122 (21%)
Smyd1NP_001100065.1 zf-MYND 52..90 CDD:280009 9/39 (23%)
SET <194..257 CDD:214614 16/62 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342720
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.