DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-5 and set5

DIOPT Version :9

Sequence 1:NP_610202.3 Gene:SmydA-5 / 35538 FlyBaseID:FBgn0033061 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_588413.1 Gene:set5 / 2538853 PomBaseID:SPCC1739.05 Length:319 Species:Schizosaccharomyces pombe


Alignment Length:146 Identity:39/146 - (26%)
Similarity:55/146 - (37%) Gaps:34/146 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 EERKGTDLYEEAEKRVVTYLQKRFLCRLKQTNPNLLTDCGPEMLHRLCGIIETNFMVIELPSGVE 247
            ||...|...||.|.          ..||...:|:.:   ||     ..|...:|.:.|:...|  
pombe    50 EEALSTKTKEEQEA----------FHRLFNAHPDTM---GP-----FLGPFYSNALTIDETKG-- 94

  Fly   248 LSGLFRQACMMEHACQPNCDFQFDNKTQQVAVRAGCDLRKGDHLRITYTNILWGTQLRQHHLR-- 310
              |:|.....|.|.|.||....::.:..||.|.|..|:..|:.:..||.:      |.:.|..  
pombe    95 --GMFLLGSRMNHDCSPNVKHTWNPRLDQVTVHAVRDIEAGEEILTTYID------LHKSHTERQ 151

  Fly   311 --LTKH--FSCRCSRC 322
              |.:|  |.|.||.|
pombe   152 KILLEHFGFKCYCSVC 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-5NP_610202.3 zf-MYND 7..43 CDD:280009
SET 185..295 CDD:279228 26/109 (24%)
set5NP_588413.1 SET <1..319 CDD:225491 39/146 (27%)
SET 4..147 CDD:214614 31/124 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2289
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.