DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-5 and Smyd5

DIOPT Version :9

Sequence 1:NP_610202.3 Gene:SmydA-5 / 35538 FlyBaseID:FBgn0033061 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_659167.2 Gene:Smyd5 / 232187 MGIID:108048 Length:416 Species:Mus musculus


Alignment Length:360 Identity:86/360 - (23%)
Similarity:133/360 - (36%) Gaps:86/360 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DAELGRYLKVTQNIAAGQIVFIEEPLVVGP-KW--------------YLSDADKEASNV---PCV 97
            |:..|:.|..||.|..|:.:|||.|||... .|              .|..|::.|..:   |..
Mouse    29 DSIKGKGLFATQLIRKGETIFIERPLVAAQFLWNALYQYRACDHCLRALEKAEENAQRLTGKPSQ 93

  Fly    98 GCYTP--CRLGK--HQ-CRRCRWPVCSAGCKHESME--CSVLSLGSGSPTRADARSLNDYFR--- 152
            ....|  |.:.|  || |..|:...|||.|:..:.|  ..:|..|.....|.....|.:.:|   
Mouse    94 ILPHPELCSVRKDLHQNCPHCQVMYCSAECRLAAAEQYHQILCPGPSHDPRHPLNKLQEAWRSVH 158

  Fly   153 -----GDALLVLKCLLLQRQSPTK--WSALL----EMQSHEEER------KG------------- 187
                 ...:|:.:.:...:|:..|  |..|.    ...:::|:.      ||             
Mouse   159 YPPETASIMLMARMVATVKQAKDKDHWVRLFNHFCSRTANQEQAIVHKLLKGKFKDQLELLLGLF 223

  Fly   188 -TDLYEEAEKRVVTYLQKRFLCRLKQTNPNLL--------------TDCGPEMLHRLCGIIETNF 237
             ..|||||.....|....|.|..|..||...:              .:..|:...:|...|:..:
Mouse   224 KEALYEEALSLWFTPEGFRSLFALVGTNGQGIGTSSLSQWVHACDALELTPQDREQLDTFIDQLY 288

  Fly   238 MVIELPSG----VELSGLF-RQACMMEHACQPNCDFQFDNKTQQVAVRAGCDLRKGDHLRITYTN 297
            ..||..:|    .|.|||| .|:| ..|:|.||.:..|......:.|.|..|::.|:.:.|:|.:
Mouse   289 KDIEAATGEFLNCEGSGLFVLQSC-CNHSCVPNAETSFPENNFVLHVTALEDIKPGEEICISYLD 352

  Fly   298 ILWGTQLRQHHLRLTKH---FSCRCSRCL----DP 325
            .....:.|....::.:.   |:|.|.:||    ||
Mouse   353 CCQRERSRHSRHKILRENYLFNCSCPKCLAEADDP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-5NP_610202.3 zf-MYND 7..43 CDD:280009
SET 185..295 CDD:279228 36/148 (24%)
Smyd5NP_659167.2 SET <297..350 CDD:214614 17/53 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..416 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.