powered by:
Protein Alignment SmydA-5 and Ankmy2
DIOPT Version :9
Sequence 1: | NP_610202.3 |
Gene: | SmydA-5 / 35538 |
FlyBaseID: | FBgn0033061 |
Length: | 553 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_666145.3 |
Gene: | Ankmy2 / 217473 |
MGIID: | 2144755 |
Length: | 440 |
Species: | Mus musculus |
Alignment Length: | 72 |
Identity: | 24/72 - (33%) |
Similarity: | 38/72 - (52%) |
Gaps: | 9/72 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 CPVCG-VAASQACTRCKMVRYCDREHQKQHWPQHKRRCRPFS---EEQDAELGRYLKVTQ----- 62
|..|| ..||:.|:.||||.|||:..||.||..||:.|:... |:|..|..::.:..:
Mouse 320 CTTCGEKGASKRCSVCKMVIYCDQTCQKTHWFAHKKMCKSLKDVYEKQQIEAAKHKRQEEKNGNP 384
Fly 63 NIAAGQI 69
|:::..:
Mouse 385 NVSSNHV 391
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S5123 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.