DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-5 and Ankmy2

DIOPT Version :9

Sequence 1:NP_610202.3 Gene:SmydA-5 / 35538 FlyBaseID:FBgn0033061 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_666145.3 Gene:Ankmy2 / 217473 MGIID:2144755 Length:440 Species:Mus musculus


Alignment Length:72 Identity:24/72 - (33%)
Similarity:38/72 - (52%) Gaps:9/72 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CPVCG-VAASQACTRCKMVRYCDREHQKQHWPQHKRRCRPFS---EEQDAELGRYLKVTQ----- 62
            |..|| ..||:.|:.||||.|||:..||.||..||:.|:...   |:|..|..::.:..:     
Mouse   320 CTTCGEKGASKRCSVCKMVIYCDQTCQKTHWFAHKKMCKSLKDVYEKQQIEAAKHKRQEEKNGNP 384

  Fly    63 NIAAGQI 69
            |:::..:
Mouse   385 NVSSNHV 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-5NP_610202.3 zf-MYND 7..43 CDD:280009 19/36 (53%)
SET 185..295 CDD:279228
Ankmy2NP_666145.3 ANK repeat 16..43 CDD:293786
ANK 30..132 CDD:238125
Ank_5 31..87 CDD:290568
ANK repeat 45..77 CDD:293786
ANK 1 45..74
Ank_5 65..120 CDD:290568
ANK repeat 79..110 CDD:293786
ANK 2 79..108
ANK 3 159..188
zf-MYND 320..357 CDD:280009 19/36 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 371..440 1/21 (5%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5123
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.