DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-5 and smyd1

DIOPT Version :9

Sequence 1:NP_610202.3 Gene:SmydA-5 / 35538 FlyBaseID:FBgn0033061 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_012811600.1 Gene:smyd1 / 100145429 XenbaseID:XB-GENE-978314 Length:491 Species:Xenopus tropicalis


Alignment Length:300 Identity:72/300 - (24%)
Similarity:122/300 - (40%) Gaps:60/300 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GRYLKVTQNIAAGQIVFIEEPLVVGPKWYLSDADKEASNVPCVGCYTPCRLGKHQ-----CRRCR 114
            ||.|:..:...||.|:|.|..       |.:......|:..|..|:      |.|     |.:|:
 Frog    13 GRGLRAIRESWAGDIIFAEPA-------YSAVVFDNLSHSVCHSCF------KRQEKLLRCGQCK 64

  Fly   115 WP-VCSAGCKHESM-----ECSVLSLGSGSPT---RADARSLNDYFRGDALLVLKCLLLQRQSPT 170
            :. .|...|:.||.     ||..:.....:|.   |..||.|....|..:.|...||:       
 Frog    65 FAHYCDRTCQKESWANHKNECVAIKKAGKAPNENIRLAARILWRIEREGSGLTEGCLV------- 122

  Fly   171 KWSALLEMQSHEEERKGTDLYEEAEKRVVTYLQKRFLCRLKQTNPNLLTDCGPEMLHRLCGIIET 235
               ::.::|:|      .|.::||||.::....::||    :..|:.....|.:.:..:..:|..
 Frog   123 ---SIDDLQNH------IDKFDEAEKGLLMEDVQKFL----EYWPSQSQQFGMQYISHIFSVISC 174

  Fly   236 NFMVIELPSGVEL--SGLFRQACMMEHACQPNCDFQFDN----------KTQ-QVAVRAGCDLRK 287
            |...:....|::.  .|:|...|:..|.|.|||...|:|          .|| ::.:||...:.|
 Frog   175 NGFTLSDQRGLQAVGVGIFPNLCLANHDCWPNCTVIFNNGNHEAVRSMFHTQMRIELRALGKINK 239

  Fly   288 GDHLRITYTNILWGTQLRQHHLRLTKHFSCRCSRCLDPTE 327
            |:.|.::|.:.|..|:.|:..|:...:|.|.|..|...|:
 Frog   240 GEELTVSYVDFLNLTEDRKAQLKKQYYFDCTCEHCTKKTK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-5NP_610202.3 zf-MYND 7..43 CDD:280009
SET 185..295 CDD:279228 29/122 (24%)
smyd1XP_012811600.1 zf-MYND 47..85 CDD:280009 10/43 (23%)
SET <189..252 CDD:214614 18/62 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2289
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.