DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7849 and PUS4

DIOPT Version :9

Sequence 1:NP_610201.1 Gene:CG7849 / 35537 FlyBaseID:FBgn0033060 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_014107.1 Gene:PUS4 / 855424 SGDID:S000005236 Length:403 Species:Saccharomyces cerevisiae


Alignment Length:268 Identity:50/268 - (18%)
Similarity:99/268 - (36%) Gaps:73/268 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MNGILNVYKPSG-------MKVKH--VRNAILS-NICKGLNEMEQ------------RKPRKLQE 58
            ||||..:.||||       :|::|  .::.:.| .|.:...|.:|            ||.||:.:
Yeast     1 MNGIFAIEKPSGITSNQFMLKLQHALTKSQVFSKEIQRATAERKQQYEKQTGKKASKRKLRKVSK 65

  Fly    59 NISLLGTGTAADHVLHNIGEQTDLSDHLLSTGPRYLPRDLICTTVSSLGDHTSGVLLFGINRGAG 123
              ..:|.|...|.:                                     .||||:.||..|..
Yeast    66 --VKMGHGGTLDPL-------------------------------------ASGVLVIGIGAGTK 91

  Fly   124 QSSSIRKNRPVRVYHLIGHLGIATENNLPDSRVIMRSNHRHVSADRISSLAASM--QASHQRKMF 186
            :.::.... .|:||......|::|.:...:..::.:::.:|::.|.:.::....  |......::
Yeast    92 KLANYLSG-TVKVYESEALFGVSTTSGDVEGEILSQNSVKHLNFDDLKTVEEKFVGQLKQTPPIY 155

  Fly   187 ELCGVDLQTQEAYELACRGLLRPADDSQPVVYGIKLI--HFDRPHF------TLELHAINETQEY 243
            ....:|.:....|....:.|.|..:..|..:|.:|:.  ...|.|.      |.| .|::..:..
Yeast   156 AALKMDGKPLHEYAREGKPLPRAIEPRQVTIYDLKVFSDSLKRDHDYPLLRPTTE-EAVDTVKNL 219

  Fly   244 LATLVHDM 251
            .|.:::|:
Yeast   220 NANMLNDV 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7849NP_610201.1 PseudoU_synth_hTruB2_like 18..292 CDD:211345 48/266 (18%)
PUS4NP_014107.1 PseudoU_synth_TruB_4 3..331 CDD:211344 48/266 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0130
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.