DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7849 and CBF5

DIOPT Version :9

Sequence 1:NP_610201.1 Gene:CG7849 / 35537 FlyBaseID:FBgn0033060 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_013276.1 Gene:CBF5 / 850872 SGDID:S000004165 Length:483 Species:Saccharomyces cerevisiae


Alignment Length:95 Identity:24/95 - (25%)
Similarity:35/95 - (36%) Gaps:5/95 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 VYGIKLIHFDRPHFTLELHAINETQEYLATLVHDMALDLRTVAHCSQLRCVRHAHFDVTDSL--L 279
            :|...||.||.........|..|...|:.||...:.:.|....|..:||.||.......|::  |
Yeast   169 IYESNLIEFDNKRNLGVFWASCEAGTYMRTLCVHLGMLLGVGGHMQELRRVRSGALSENDNMVTL 233

  Fly   280 RHAWHLPGIIKNLRQQ---RDILRAHPQLL 306
            ........:..|.|.:   |.|::....||
Yeast   234 HDVMDAQWVYDNTRDESYLRSIIQPLETLL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7849NP_610201.1 PseudoU_synth_hTruB2_like 18..292 CDD:211345 18/76 (24%)
CBF5NP_013276.1 CBF5 26..351 CDD:273073 24/95 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0130
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.