DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7849 and AT5G14460

DIOPT Version :9

Sequence 1:NP_610201.1 Gene:CG7849 / 35537 FlyBaseID:FBgn0033060 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_196950.2 Gene:AT5G14460 / 831297 AraportID:AT5G14460 Length:540 Species:Arabidopsis thaliana


Alignment Length:209 Identity:44/209 - (21%)
Similarity:74/209 - (35%) Gaps:47/209 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SLGDHTSGVLLFGINRGAGQSSSI--RKNRPVRVYHLIGHLGIATENNLPDSRVIMRSNHRHVSA 167
            :|....:|:|:..:    |:::.:  |....::.|..:..||.||.....||.||.|.:..|:..
plant   355 TLDPMATGLLIVCV----GKATKVVDRYQGMIKGYSGVFRLGEATSTLDADSPVIQRESWEHIKD 415

  Fly   168 DRISSLAASMQASHQRKMFELCGVDLQTQEAYELACRG----------------LLRPADDSQPV 216
            |.|.....|......:.......:.:..::.||.|.||                :.|..||.|.:
plant   416 DDIKKALTSFLGEIWQVPPMFSAIKVGGEKMYEKARRGETVELSPRRISIFQFDIERSLDDRQNL 480

  Fly   217 VYGIKLIHFDRPHFTLELHAINETQEYLATLVHDMALDLRTVAHCSQLRCVRHAHFDVTDSLLRH 281
            ::.:                |.....|:.:|..|:|..|.:.||.:.||......:...|     
plant   481 IFRV----------------ICSKGTYIRSLCADLAKALGSCAHLTALRRDSIGEYSAND----- 524

  Fly   282 AWHL----PGIIKN 291
            ||..    ..|.||
plant   525 AWEFNELEAAITKN 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7849NP_610201.1 PseudoU_synth_hTruB2_like 18..292 CDD:211345 44/209 (21%)
AT5G14460NP_196950.2 PseudoU_synth_EcTruB 323..534 CDD:211339 41/203 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0130
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.