DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7849 and trub2

DIOPT Version :9

Sequence 1:NP_610201.1 Gene:CG7849 / 35537 FlyBaseID:FBgn0033060 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001011086.1 Gene:trub2 / 496499 XenbaseID:XB-GENE-996199 Length:325 Species:Xenopus tropicalis


Alignment Length:306 Identity:105/306 - (34%)
Similarity:167/306 - (54%) Gaps:20/306 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AATVFKHMNGILNVYKPSGMKVKHVRNAILSNICKGLNEMEQRKPRKLQENISLLGTGTAADHVL 73
            |..||:.::|:..||||.|:..|.||:.:.:|:.|.||.::||.||   :.|..|..||...:.|
 Frog     5 APGVFRTLHGLFAVYKPPGVHWKSVRDTVETNLLKELNALKQRPPR---QQIRFLPAGTEGSNGL 66

  Fly    74 HNIGEQTD-------LSDHLLSTGPRYLPRDLICTTVSSLGDHTSGVLLFGINRGAGQSSSIRKN 131
                |.|.       |:||:|..||.:  ..:...|...|...:|||.:.||..|......:..:
 Frog    67 ----EVTRVPSAVPVLADHVLVKGPAF--THIRVGTGHRLDIQSSGVFVLGIGHGNKLLKDMYNS 125

  Fly   132 RPVRVYHLIGHLGIATENNLPDSRVIMRSNHRHVSADRISSLAASMQASHQRKMFELCGVDLQTQ 196
            ...|.|.:.|.||.|||:.....:.|.::.:.|::.:::..:.|.:|.::|:.:.....:|||:|
 Frog   126 HFTRDYTVRGMLGKATEDFTELGKTIEKTTYDHITREKLERILAVIQGTNQKALITHSHLDLQSQ 190

  Fly   197 EAYELACRGLLRPADDSQPVVYGIKLIHFDRPHFTLELHAINETQEYLATLVHDMALDLRTVAHC 261
            |||:||.:|.|||...|.|::.||:.:.|..|.||||:..::|||:||..::|::.|:||:.|.|
 Frog   191 EAYDLAVQGKLRPMVKSPPIILGIRCLEFSPPEFTLEIQCMHETQQYLRKMIHEIGLELRSSAVC 255

  Fly   262 SQLRCVRHAHFDVTDSLLRHAWHL---PGIIKNLRQQRD-ILRAHP 303
            :|:|..|...|.|..||||..|.|   .|.|:..|.|.: :.|.:|
 Frog   256 TQVRRSRDGPFTVDCSLLRTQWDLGSIQGAIRECRAQTEGVSRGNP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7849NP_610201.1 PseudoU_synth_hTruB2_like 18..292 CDD:211345 98/283 (35%)
trub2NP_001011086.1 PseudoU_synth_hTruB2_like 14..286 CDD:211345 97/280 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..325 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7812
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41056
Inparanoid 1 1.050 168 1.000 Inparanoid score I4029
OMA 1 1.010 - - QHG46022
OrthoDB 1 1.010 - - D1535798at2759
OrthoFinder 1 1.000 - - FOG0006468
OrthoInspector 1 1.000 - - otm48985
Panther 1 1.100 - - LDO PTHR13195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5437
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.