DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7849 and Nop60B

DIOPT Version :9

Sequence 1:NP_610201.1 Gene:CG7849 / 35537 FlyBaseID:FBgn0033060 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001014547.1 Gene:Nop60B / 37873 FlyBaseID:FBgn0259937 Length:508 Species:Drosophila melanogaster


Alignment Length:230 Identity:49/230 - (21%)
Similarity:81/230 - (35%) Gaps:63/230 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 NRPVRVYHLIGHLGIATENNLPDSRVIM----------RSNHRH-----------VSADRISSLA 174
            ||.::.|...|.:.:...:| |.|..::          ::.|..           |..||.:.|.
  Fly    78 NRDIKEYMKTGFINLDKPSN-PSSHEVVAWIKKILKVEKTGHSGTLDPKVTGCLIVCIDRATRLV 141

  Fly   175 ASMQASHQR--KMFELCGVDLQTQEAYELACRGL--LRPADDSQP-------------VVYGIKL 222
            .|.|::.:.  .:|:|.|    ..|:.....:||  ||.|...:|             .||..||
  Fly   142 KSQQSAGKEYVAIFKLHG----AVESVAKVRQGLEKLRGALFQRPPLISAVKRQLRVRTVYDSKL 202

  Fly   223 IHFDRPHFTLELHAINETQEYLATLVHDMALDLRTVAHCSQLRCVRHA-----------HFDVTD 276
            :.:|............|...|:.|:...:.|.|.......:||.||..           | ||.|
  Fly   203 LDYDETRNMGVFWVSCEAGSYIRTMCVHLGLVLGVGGQMLELRRVRSGIQSERDGMVTMH-DVLD 266

  Fly   277 SLLRHAWH-----LPGIIKNLRQQRDILRAHPQLL 306
            ::..:..|     |..:||.|   ..:|..|.:::
  Fly   267 AMWLYENHKDESMLRRVIKPL---EGLLVNHKRII 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7849NP_610201.1 PseudoU_synth_hTruB2_like 18..292 CDD:211345 46/214 (21%)
Nop60BNP_001014547.1 DKCLD 47..104 CDD:285330 7/26 (27%)
CBF5 54..379 CDD:273073 49/230 (21%)
PseudoU_synth_hDyskerin 86..268 CDD:211338 39/187 (21%)
PUA 295..368 CDD:279774 0/4 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0130
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.