DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7849 and Trub1

DIOPT Version :9

Sequence 1:NP_610201.1 Gene:CG7849 / 35537 FlyBaseID:FBgn0033060 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_008758760.1 Gene:Trub1 / 361775 RGDID:1308502 Length:345 Species:Rattus norvegicus


Alignment Length:316 Identity:67/316 - (21%)
Similarity:114/316 - (36%) Gaps:76/316 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KVYDAATVFKHM--NGILNVYKPSGMKVKHVRNAILSNICKGLN--------EMEQRKPRKLQEN 59
            :|..||...|.|  :|:..|:||.|.....:.|.:...:..|..        |..:|:.:.|:  
  Rat    46 QVSKAALAAKLMSLSGVFAVHKPKGPTSAELLNRLKEKLLAGTRPEAGLPSPEWNKRQKQTLK-- 108

  Fly    60 ISLLGTGTAADHVLHNIGEQTDLSDHLLSTGPRYLPRDLICTTVSSLGDHTSGVLLFGINRGAGQ 124
               :|.|                                     .:|.....|||:.||.||...
  Rat   109 ---VGHG-------------------------------------GTLDSAAQGVLVVGIGRGTKM 133

  Fly   125 SSSIRKNRPVRVYHLIGHLGIATENNLPDSRVIMRSNHRHVSADRISSLAAS-----MQASHQRK 184
            .:|:....  :.|...|.||.||:......:|.....:..::.:.|..:...     ||......
  Rat   134 LTSMLSGS--KRYIATGELGKATDTLDSTGKVTEEKPYDKITQEDIEGILQKFTGNIMQVPPLYS 196

  Fly   185 MFELCGVDLQTQEAYELACRGLLRPADDSQPV-VYGIKLIHFDRPHFTLELHAINETQEYLATLV 248
            ..:..|..|.|     |..||....|..::|| |:.|.|:.:..|.|||::......  |:.:||
  Rat   197 ALKKDGQRLST-----LMKRGETVEARPARPVTVHSISLLKYQPPFFTLDVECGGGF--YIRSLV 254

  Fly   249 HDMALDLRTVAHCSQLRCVRHAHFDVTDSLLRHA-----WHLPGIIKNLRQQRDIL 299
            .|:..:|.:.|...:|...:...|    :|.:||     |.:..|.::|::...:|
  Rat   255 SDIGKELSSCATVLELTRTKQGPF----TLAQHALPEDRWTINDIAQSLKRCTSLL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7849NP_610201.1 PseudoU_synth_hTruB2_like 18..292 CDD:211345 60/292 (21%)
Trub1XP_008758760.1 PseudoU_synth 61..340 CDD:294089 62/301 (21%)
TruB 61..282 CDD:129523 56/275 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0130
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535798at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.