DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7849 and SPBC11C11.10

DIOPT Version :9

Sequence 1:NP_610201.1 Gene:CG7849 / 35537 FlyBaseID:FBgn0033060 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_596400.1 Gene:SPBC11C11.10 / 2540023 PomBaseID:SPBC11C11.10 Length:407 Species:Schizosaccharomyces pombe


Alignment Length:241 Identity:48/241 - (19%)
Similarity:81/241 - (33%) Gaps:60/241 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GILNVYKPSGMKVKHVRN---AILSNICKGLNEMEQ-----------RKPRKLQENISLLGTGTA 68
            |::.:.||||.......|   .|:||     :|:.|           |..|:.:.|         
pombe    51 GLIAINKPSGRTSAQCLNELKKIISN-----SELAQYFRPAPPHPNDRNRRRRKSN--------- 101

  Fly    69 ADHVLHNIGEQTDLSDHLLSTGPRYLPRDLICTTVSSLGDHTSGVLLFGINRGAGQSSSIRKNRP 133
                        .|.|..:..|             .:|....||||:.|:..|..|.||:..  .
pombe   102 ------------RLPDIKIGHG-------------GTLDPLASGVLVVGLGTGTKQLSSLLS--C 139

  Fly   134 VRVYHLIGHLGIATENNLPDSRVIMRSNHRHVSADRISSLAASM-QASHQRKMFELCGVDLQTQE 197
            ::.|......|.:|:......::|..:.|.....:.:|.|.|.. ..|....::.  .:.:|.:.
pombe   140 MKTYRATALFGCSTDTYDSAGKIIKIAVHIPTKEEILSGLDAFRGDISQLPPLYS--ALHIQGKR 202

  Fly   198 AYELACRGLLRPADDSQPVVYGIKLIHFDRPHFTLELHAINETQEY 243
            .||.|..|:..|.......::..:||..|  ....|.|...:..|:
pombe   203 LYEYAREGIPLPESIKARSMHCEELILKD--FIPKEEHTYTDPDEF 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7849NP_610201.1 PseudoU_synth_hTruB2_like 18..292 CDD:211345 48/241 (20%)
SPBC11C11.10NP_596400.1 TruB 36..405 CDD:223208 48/241 (20%)
PseudoU_synth_TruB_4 51..390 CDD:211344 48/241 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0130
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.