DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7849 and DKC1

DIOPT Version :9

Sequence 1:NP_610201.1 Gene:CG7849 / 35537 FlyBaseID:FBgn0033060 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001354.1 Gene:DKC1 / 1736 HGNCID:2890 Length:514 Species:Homo sapiens


Alignment Length:106 Identity:24/106 - (22%)
Similarity:42/106 - (39%) Gaps:20/106 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 VYGIKLIHFDRPHFTLELHAIN-ETQEYLATLVHDMALDLRTVAHCSQLRCVRHA------HFDV 274
            :|..|:|.:| |...|.:..:: |...|:.||...:.|.|.......:||.||..      |...
Human   199 IYESKMIEYD-PERRLGIFWVSCEAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVT 262

  Fly   275 TDSLLRHAW---------HLPGIIKNLRQQRDILRAHPQLL 306
            ...:|...|         :|..::..|.:   :|.:|.:|:
Human   263 MHDVLDAQWLYDNHKDESYLRRVVYPLEK---LLTSHKRLV 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7849NP_610201.1 PseudoU_synth_hTruB2_like 18..292 CDD:211345 20/90 (22%)
DKC1NP_001354.1 Nucleolar localization 2..21
CBF5 56..381 CDD:273073 24/106 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..514
Nuclear and nucleolar localization 446..514
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0130
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.