DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7849 and TRUB1

DIOPT Version :9

Sequence 1:NP_610201.1 Gene:CG7849 / 35537 FlyBaseID:FBgn0033060 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_631908.1 Gene:TRUB1 / 142940 HGNCID:16060 Length:349 Species:Homo sapiens


Alignment Length:309 Identity:67/309 - (21%)
Similarity:109/309 - (35%) Gaps:58/309 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ATVFKHMNGILNVYKPSGMKVKHVRNAILSNIC--KGLNEMEQRKPRKLQENISLLGTGTAADHV 72
            ||....::|:..|:||.|.....:.|.:...:.  .|:...|..|.:|....|...||       
Human    62 ATKLLSLSGVFAVHKPKGPTSAELLNRLKEKLLAEAGMPSPEWTKRKKQTLKIGHGGT------- 119

  Fly    73 LHNIGEQTDLSDHLLSTGPRYLPRDLICTTVSSLGDHTSGVLLFGINRGAGQSSSIRKNRPVRVY 137
                                             |.....|||:.||..|....:|:....  :.|
Human   120 ---------------------------------LDSAARGVLVVGIGSGTKMLTSMLSGS--KRY 149

  Fly   138 HLIGHLGIATENNLPDSRVIMRSNHRHVSADRISSLAAS-----MQASHQRKMFELCGVDLQTQE 197
            ..||.||.||:......||.....:..::.:.|..:...     ||........:..|..|.|  
Human   150 TAIGELGKATDTLDSTGRVTEEKPYDKITQEDIEGILQKFTGNIMQVPPLYSALKKDGQRLST-- 212

  Fly   198 AYELACRGLLRPADDSQPV-VYGIKLIHFDRPHFTLELHAINETQEYLATLVHDMALDLRTVAHC 261
               |..||.:..|..::|| ||.|.|..|..|.|||::......  |:.:||.|:..:|.:.|:.
Human   213 ---LMKRGEVVEAKPARPVTVYSISLQKFQPPFFTLDVECGGGF--YIRSLVSDIGKELSSCANV 272

  Fly   262 SQLRCVRHAHFDVTD-SLLRHAWHLPGIIKNLRQQRDILRAHPQLLRQQ 309
            .:|...:...|.:.: :|....|.:..|.::|.....:..|...|.:.:
Human   273 LELTRTKQGPFTLEEHALPEDKWTIDDIAQSLEHCSSLFPAELALKKSK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7849NP_610201.1 PseudoU_synth_hTruB2_like 18..292 CDD:211345 62/282 (22%)
TRUB1NP_631908.1 PseudoU_synth_TruB_4 70..348 CDD:211344 65/301 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0130
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535798at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.