DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa2-R and gpr39

DIOPT Version :9

Sequence 1:NP_001356958.1 Gene:CCHa2-R / 35535 FlyBaseID:FBgn0033058 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_956711.1 Gene:gpr39 / 791773 ZFINID:ZDB-GENE-040426-1395 Length:440 Species:Danio rerio


Alignment Length:372 Identity:93/372 - (25%)
Similarity:159/372 - (42%) Gaps:76/372 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 VTVLYTLIFIVGVLGNGTLV---IIFFRHRSMRNIPNTYILSLALADLLVILVCVPVATIVYTQE 133
            :||||.||..:|||||...:   .:..|:..::.....:::|||.:||||:|:.:||.  :|:..
Zfish    23 LTVLYCLILSLGVLGNSATIHVAQVLQRNGYLQRSVAEHMVSLACSDLLVLLIGLPVE--LYSAI 85

  Fly   134 SWPF-ERN---MCRISEFFKDISIGVSVFTLTALSGERYCAIVNP-----LRKLQTKPLTVFTAV 189
            .:|| .|:   .|||..|..::....::..:..||.|||.||.:|     ||..:|:.|    .:
Zfish    86 WFPFLSRSGDAACRIYNFLFELCSYATILNVATLSLERYLAICHPFRYRALRGGRTRRL----LL 146

  Fly   190 MIWILAILLGMPSVLFSDIKSY-PVFTATGNMTIEVCSP-------FRDPEYAKFMVAGKALVYY 246
            ..|:.:.|:.:|.::.:..:.| |....|....:..|:.       :|...:..|       |.|
Zfish   147 AAWLCSALVALPLLVATGTEGYVPAGRQTPVQNLTFCTSLSQHWVMYRTSIFTAF-------VLY 204

  Fly   247 LLPLSIIGALYIMMAKRLHMSARNMP------GEQQSMQSRTQARARLHVARMVVAFVVVFFICF 305
            ||.|:  |..::..|..|.:.|...|      |:.:...:|.:| :|......:|..|...|:|:
Zfish   205 LLVLA--GVAFMCRAMILVLRAPMGPAEAGASGDHKHQSARGKA-SRKQTILFLVLIVCALFVCW 266

  Fly   306 FPYHVFEL---------WYHFY--------PTAEEDFDEFWNVLRIVGFCTSFLNSCVNPVALYC 353
            .|..:..|         |...|        |.|:..|               :|:|.:||:....
Zfish   267 MPNQIRRLMTAAVPKSSWTGSYLTSYIKLHPVADSFF---------------YLSSVLNPMLYNL 316

  Fly   354 VSGVFRQHFNRYLCCICVKRQPHLR--QHSTATGMMDNTSVMSMRRS 398
            .|..||..|.:.|.|....:..:.|  ::|.|:...:||....::||
Zfish   317 SSRQFRSAFLQTLLCRLSLQHANRRTLENSGASKSSNNTLRPLLQRS 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa2-RNP_001356958.1 7tmA_Bombesin_R-like 70..362 CDD:320593 83/332 (25%)
TM helix 1 71..97 CDD:320593 11/27 (41%)
TM helix 2 104..130 CDD:320593 10/25 (40%)
TM helix 3 142..172 CDD:320593 10/29 (34%)
TM helix 4 182..202 CDD:320593 3/19 (16%)
TM helix 5 234..259 CDD:320593 7/24 (29%)
TM helix 6 285..315 CDD:320593 7/38 (18%)
TM helix 7 330..355 CDD:320593 4/24 (17%)
gpr39NP_956711.1 7tm_1 37..314 CDD:278431 71/307 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.