DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa2-R and TACR2

DIOPT Version :9

Sequence 1:NP_001356958.1 Gene:CCHa2-R / 35535 FlyBaseID:FBgn0033058 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001048.2 Gene:TACR2 / 6865 HGNCID:11527 Length:398 Species:Homo sapiens


Alignment Length:378 Identity:94/378 - (24%)
Similarity:157/378 - (41%) Gaps:51/378 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 YTLIFIVGVLGNGTLVIIFFRHRSMRNIPNTYILSLALADLLVILVCVPVATIVYTQESWPFERN 140
            |..:.:|.|.||..::.|...||.||.:.|.:|::||||||.:.........:..:...|.|.|.
Human    40 YLALVLVAVTGNAIVIWIILAHRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRA 104

  Fly   141 MCRISEFFKDISIGVSVFTLTALSGERYCAIVNPLRKLQTKPLTVFTAVMIWILAILLGMPSVLF 205
            .|.....|...::.||::::||::.:||.|||:|.:...:.|.|......||::|:.|..|...:
Human   105 FCYFQNLFPITAMFVSIYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFY 169

  Fly   206 SDIKSYPVFTATGNMTIEVCSPFRDPEYAKFMVA------GKAL---------VYYLLPLSIIGA 255
            |.:.                   .|....|.:||      ||.|         :.|.|||:::..
Human   170 STVT-------------------MDQGATKCVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFV 215

  Fly   256 LYIMMAKRLHMSARNMPGEQQSMQSRTQARARLHVARMVVAFVVVFFICFFPYHVFELWYHFYPT 320
            .|.::.  |.:..|.:||.|....:....:|.....:.:|..|:.|.||:.|||:    |....:
Human   216 AYSVIG--LTLWRRAVPGHQAHGANLRHLQAMKKFVKTMVLVVLTFAICWLPYHL----YFILGS 274

  Fly   321 AEEDF--DEFWNVLRIVGFCTSFLNSCVNPVALYCVSGVFRQHFN-RYLCCICVKRQPHLRQHST 382
            .:||.  .:|...:.:..|..:..::..||:...|::..||..|. .:.||..|......:...|
Human   275 FQEDIYCHKFIQQVYLALFWLAMSSTMYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELT 339

  Fly   383 ATGMMDNTSVMSMRRSTYVGGT---AGNLRASLHRNSNHGVGGAGGGVGGGVG 432
            .|     ||:.:.....:...|   ||:...|...:...|....|.|:..|.|
Human   340 PT-----TSLSTRVNRCHTKETLFMAGDTAPSEATSGEAGRPQDGSGLWFGYG 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa2-RNP_001356958.1 7tmA_Bombesin_R-like 70..362 CDD:320593 77/302 (25%)
TM helix 1 71..97 CDD:320593 6/20 (30%)
TM helix 2 104..130 CDD:320593 8/25 (32%)
TM helix 3 142..172 CDD:320593 9/29 (31%)
TM helix 4 182..202 CDD:320593 6/19 (32%)
TM helix 5 234..259 CDD:320593 11/39 (28%)
TM helix 6 285..315 CDD:320593 9/29 (31%)
TM helix 7 330..355 CDD:320593 4/24 (17%)
TACR2NP_001048.2 7tm_4 42..>168 CDD:304433 39/125 (31%)
7tm_1 50..307 CDD:278431 71/281 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4219
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.