DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa2-R and CG13575

DIOPT Version :9

Sequence 1:NP_001356958.1 Gene:CCHa2-R / 35535 FlyBaseID:FBgn0033058 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_611903.1 Gene:CG13575 / 37883 FlyBaseID:FBgn0034996 Length:521 Species:Drosophila melanogaster


Alignment Length:394 Identity:84/394 - (21%)
Similarity:144/394 - (36%) Gaps:122/394 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 IVPYVPV-------LDRPETYIVTVLYTLIFIVGVLGNGTLVIIFFRHRSMRNIPNTYILSLALA 114
            |.||..|       |:|.:.:..:.:...:|::...||.:.:.:..| |.:|......::|||.:
  Fly    31 IQPYPGVFVGDLSQLNRFKRHAFSAVVGTLFVLAFCGNLSTLYVNSR-RKLRPFFRACLISLACS 94

  Fly   115 DLLVILVCVPVATIVYTQ-------ESWPFERNMCRISEFFKDISIGVSVFTLTALSGERYCAIV 172
            ||:..:.|    |:.|..       :.|.....||:...|....|:.....||.|::.:||.|::
  Fly    95 DLVSSIFC----TVSYMAQFQAQYLQLWTIGGFMCKFVPFITTTSVLSGSLTLVAIALDRYLAVM 155

  Fly   173 NPLRKLQT--KPLTVFTAVMIWILAI-----LLGM---PSVLFSDI-----KSYPVFTA------ 216
            .|:....:  |..:..:.::||..:|     |||:   ..:...|:     :|..|.||      
  Fly   156 RPVLGFWSPDKRFSTLSMLLIWACSIGSSGPLLGIYDYRKIYLLDVEDSSEESEEVVTAVPEELV 220

  Fly   217 -TGNMTIEVC------------------------------------------------SPFRDPE 232
             |....:.:|                                                ...::|:
  Fly   221 VTELEMVHMCLAGDHDVGLYYVILFTLIFLPCIVSFLWLNAVIARQLWLRRHYHQEQQEQHQEPK 285

  Fly   233 YAKF--MVAGKALVYYLLPLSIIGALYIMMAKRLH------MSARNMPGEQQSMQSRTQARARLH 289
            ..:|  |..|..|   |:|.:::.|:.:.:...|.      .|..|.||:      :|.|.|...
  Fly   286 EGQFKTMANGGDL---LMPSTLVSAMGVAVPFALDNTPLPPKSTVNAPGK------KTTAAALAR 341

  Fly   290 VAR-----MVVAFVVVFFICF-FPYHVFELWYHFYPTAEEDFDEFWNVLRIVGFCTSFLN--SC- 345
            .||     :||..::..|||. .|..|| |....|.:..|..|  |    ::.|....||  || 
  Fly   342 EARHRKMVVVVLLMMAVFICLRLPAWVF-LIMRLYGSYSEPID--W----LLYFSFGILNLFSCA 399

  Fly   346 VNPV 349
            :||:
  Fly   400 LNPI 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa2-RNP_001356958.1 7tmA_Bombesin_R-like 70..362 CDD:320593 78/374 (21%)
TM helix 1 71..97 CDD:320593 3/25 (12%)
TM helix 2 104..130 CDD:320593 7/25 (28%)
TM helix 3 142..172 CDD:320593 9/29 (31%)
TM helix 4 182..202 CDD:320593 6/27 (22%)
TM helix 5 234..259 CDD:320593 7/26 (27%)
TM helix 6 285..315 CDD:320593 12/35 (34%)
TM helix 7 330..355 CDD:320593 7/23 (30%)
CG13575NP_611903.1 7tm_1 67..>188 CDD:278431 29/125 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4219
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.