DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa2-R and Ednra

DIOPT Version :9

Sequence 1:NP_001356958.1 Gene:CCHa2-R / 35535 FlyBaseID:FBgn0033058 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_036682.1 Gene:Ednra / 24326 RGDID:2535 Length:426 Species:Rattus norvegicus


Alignment Length:394 Identity:112/394 - (28%)
Similarity:185/394 - (46%) Gaps:60/394 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 ADGGIVPYVPVLDRPET---YIVTVLYTLIFIVGVLGNGTLVIIFFRHRSMRNIPNTYILSLALA 114
            ::|.:..|.|...:..|   ||.||:...|||||::||.||:.|.::::.|||.||..|.||||.
  Rat    61 SNGSMHGYCPQQTKITTAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALG 125

  Fly   115 DLLVILVCVPVATIVYTQESWPFERN-----MCRISEFFKDISIGVSVFTLTALSGERYCAIVN- 173
            ||:.:::.:|:.........|||:.|     :|::..|.:..|:|::|..|.|||.:||.|:.: 
  Rat   126 DLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASW 190

  Fly   174 --------PLRKLQTKPLTVFTAVMIWILAILLGMPSVL------FSDIKSYPVFTATGNMTIEV 224
                    ||       :|....|.||||:.:|.:|..:      | :.|.....|...|.|.:.
  Rat   191 SRVQGIGIPL-------ITAIEIVSIWILSFILAIPEAIGFVMVPF-EYKGEQHRTCMLNATTKF 247

  Fly   225 CSPFRDPEYAKFMVAGKALVYYLLPLSIIGALYIMMAKRLHMSARNMPGEQQSMQSRTQARARLH 289
            ...::|.:  .:.:.|   .|:.:||......|.:|...: ::.||  |..:...|. ..:.|..
  Rat   248 MEFYQDVK--DWWLFG---FYFCMPLVCTAIFYTLMTCEM-LNRRN--GSLRIALSE-HLKQRRE 303

  Fly   290 VARMVVAFVVVFFICFFPYHVFELWYHFYPTAEEDFDE-------FWNVLRIVGFCTSFLNSCVN 347
            ||:.|...||:|.:|:||.|:..:   ...|..::.|:       |..::..:|...:.:|||:|
  Rat   304 VAKTVFCLVVIFALCWFPLHLSRI---LKKTVYDEMDKNRCELLSFLLLMDYIGINLATMNSCIN 365

  Fly   348 PVALYCVSGVFRQHFNRYLCCICVKRQPHLRQHSTATGMMDNTSVMSMRRSTYVGGTAGNLRASL 412
            |:|||.||..|:..|...|||.|     |..:....:..|:.||:....:.     ...|...|.
  Rat   366 PIALYFVSKKFKNCFQSCLCCCC-----HQSKSLMTSVPMNGTSIQWKNQE-----QNHNTERSS 420

  Fly   413 HRNS 416
            |::|
  Rat   421 HKDS 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa2-RNP_001356958.1 7tmA_Bombesin_R-like 70..362 CDD:320593 95/318 (30%)
TM helix 1 71..97 CDD:320593 13/25 (52%)
TM helix 2 104..130 CDD:320593 10/25 (40%)
TM helix 3 142..172 CDD:320593 12/29 (41%)
TM helix 4 182..202 CDD:320593 7/19 (37%)
TM helix 5 234..259 CDD:320593 5/24 (21%)
TM helix 6 285..315 CDD:320593 11/29 (38%)
TM helix 7 330..355 CDD:320593 9/24 (38%)
EdnraNP_036682.1 7tm_1 97..367 CDD:278431 79/289 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.